NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6059.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6059.1 Public Homo sapiens 8 CHRNA2 20 108 85 CCDS HistoryNCBI Gene:1135Re-query CCDS DB by CCDS ID:6059.1Re-query CCDS DB by GeneID:1135See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6059.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000407991 ENSP00000385026 Accepted alive Link to Ensembl Transcript Viewer:ENST00000407991Link to Ensembl Protein Viewer:ENSP00000385026Re-query CCDS DB by Nucleotide ID:ENST00000407991Re-query CCDS DB by Protein ID:ENSP00000385026
Original member Current member EBI,WTSI OTTHUMT00000376125 OTTHUMP00000225235 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000376125Link to Vega Protein Viewer:OTTHUMP00000225235Re-query CCDS DB by Nucleotide ID:OTTHUMT00000376125Re-query CCDS DB by Protein ID:OTTHUMP00000225235
Original member Current member NCBI NM_000742.3 NP_000733.2 Accepted alive Link to Nucleotide Sequence:NM_000742.3Link to Protein Sequence:NP_000733.2Re-query CCDS DB by Nucleotide ID:NM_000742Re-query CCDS DB by Protein ID:NP_000733Link to BLink:NP_000733.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000733.2 529 Q15822-1 529 100% 0 0

Chromosomal Locations for CCDS 6059.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 27461629 27461754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 27462979 27463993 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 27467229 27467338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 27469335 27469379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 27469761 27469981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 27470986 27471058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1590 nt):
ATGGGCCCCTCCTGTCCTGTGTTCCTGTCCTTCACAAAGCTCAGCCTGTGGTGGCTCCTTCTGACCCCAG
CA
GGTGGAGAGGAAGCTAAGCGCCCACCTCCCAGGGCTCCTGGAGACCCACTCTCCTCTCCCAGTCCCAC
G
GCATTGCCGCAGGGAGGCTCGCATACCGAGACTGAGGACCGGCTCTTCAAACACCTCTTCCGGGGCTAC
AAC
CGCTGGGCGCGCCCGGTGCCCAACACTTCAGACGTGGTGATTGTGCGCTTTGGACTGTCCATCGCTC
AG
CTCATCGATGTGGATGAGAAGAACCAAATGATGACCACCAACGTCTGGCTAAAACAGGAGTGGAGCGA
C
TACAAACTGCGCTGGAACCCCACTGATTTTGGCAACATCACATCTCTCAGGGTCCCTTCTGAGATGATC
TGG
ATCCCCGACATTGTTCTCTACAACAATGCAGATGGGGAGTTTGCAGTGACCCACATGACCAAGGCCC
AC
CTCTTCTCCACGGGCACTGTGCACTGGGTGCCCCCGGCCATCTACAAGAGCTCCTGCAGCATCGACGT
C
ACCTTCTTCCCCTTCGACCAGCAGAACTGCAAGATGAAGTTTGGCTCCTGGACTTATGACAAGGCCAAG
ATC
GACCTGGAGCAGATGGAGCAGACTGTGGACCTGAAGGACTACTGGGAGAGCGGCGAGTGGGCCATCG
TC
AATGCCACGGGCACCTACAACAGCAAGAAGTACGACTGCTGCGCCGAGATCTACCCCGACGTCACCTA
C
GCCTTCGTCATCCGGCGGCTGCCGCTCTTCTACACCATCAACCTCATCATCCCCTGCCTGCTCATCTCC
TGC
CTCACTGTGCTGGTCTTCTACCTGCCCTCCGACTGCGGCGAGAAGATCACGCTGTGCATTTCGGTGC
TG
CTGTCACTCACCGTCTTCCTGCTGCTCATCACTGAGATCATCCCGTCCACCTCGCTGGTCATCCCGCT
C
ATCGGCGAGTACCTGCTGTTCACCATGATCTTCGTCACCCTGTCCATCGTCATCACCGTCTTCGTGCTC
AAT
GTGCACCACCGCTCCCCCAGCACCCACACCATGCCCCACTGGGTGCGGGGGGCCCTTCTGGGCTGTG
TG
CCCCGGTGGCTTCTGATGAACCGGCCCCCACCACCCGTGGAGCTCTGCCACCCCCTACGCCTGAAGCT
C
AGCCCCTCTTATCACTGGCTGGAGAGCAACGTGGATGCCGAGGAGAGGGAGGTGGTGGTGGAGGAGGAG
GAC
AGATGGGCATGTGCAGGTCATGTGGCCCCCTCTGTGGGCACCCTCTGCAGCCACGGCCACCTGCACT
CT
GGGGCCTCAGGTCCCAAGGCTGAGGCTCTGCTGCAGGAGGGTGAGCTGCTGCTATCACCCCACATGCA
G
AAGGCACTGGAAGGTGTGCACTACATTGCCGACCACCTGCGGTCTGAGGATGCTGACTCTTCGGTGAAG
GAG
GACTGGAAGTATGTTGCCATGGTCATCGACAGGATCTTCCTCTGGCTGTTTATCATCGTCTGCTTCC
TG
GGGACCATCGGCCTCTTTCTGCCTCCGTTCCTAGCTGGAATGATCTGA


Translation (529 aa):
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHLFRGY
N
RWARPVPNTSDVVIVRFGLSIAQLIDV
DEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMI
W
IPDIVLYN
NADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAK
I
DLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLIS
C
LTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVL
N
VHHRSPSTHTMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
D
RWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHLRSEDADSS
VK
E
DWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser