NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS59545.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59545.1 Public Mus musculus 10 Ank3 21 106 86 CCDS HistoryNCBI Gene:11735Re-query CCDS DB by CCDS ID:59545.1Re-query CCDS DB by GeneID:11735See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 13, NCBI annotation release 103, Ensembl annotation release 72

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59545.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000182155 ENSMUSP00000138347 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000182155Link to Ensembl Protein Viewer:ENSMUSP00000138347Re-query CCDS DB by Nucleotide ID:ENSMUST00000182155Re-query CCDS DB by Protein ID:ENSMUSP00000138347
Original member Current member EBI,WTSI OTTMUST00000113793 OTTMUSP00000063578 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000113793Link to Vega Protein Viewer:OTTMUSP00000063578Re-query CCDS DB by Nucleotide ID:OTTMUST00000113793Re-query CCDS DB by Protein ID:OTTMUSP00000063578
Original member Current member NCBI NM_170728.2 NP_733924.2 Accepted alive Link to Nucleotide Sequence:NM_170728.2Link to Protein Sequence:NP_733924.2Re-query CCDS DB by Nucleotide ID:NM_170728Re-query CCDS DB by Protein ID:NP_733924Link to BLAST:NP_733924.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_733924.2 1726 G5E8K5-2 1726 100% 0 0

Chromosomal Locations for CCDS 59545.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 69534222 69534284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69808416 69808517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69808873 69808971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69809171 69809269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69815695 69815793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69822208 69822393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69824318 69824416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69850106 69850204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69867385 69867483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69871002 69871199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69874790 69874888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69877830 69877928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69879893 69879991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69882361 69882558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69884747 69884845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69885139 69885237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69892322 69892519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69893445 69893543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69898041 69898139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69898228 69898326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69898994 69899089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69904198 69904270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69927695 69927818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69932394 69932496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69950952 69951058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69955926 69956150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69958918 69959072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69973722 69973933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69976048 69976255 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69977713 69977809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69978471 69978699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69979318 69979443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69980272 69980394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69982116 69982197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69994372 69994446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69998095 69998226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 69999355 69999498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 70002511 70002601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 70004610 70004991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 70015568 70015633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5181 nt):
ATGAGTGAAGAGCCAAAGGAGAAGCCCGCCAAGCCTGCTCATAGGAAGAGGAAAGGAAAAAAGTCTGATG
CC
AACGCAAGTTACTTAAGAGCAGCTCGGGCAGGGCACCTGGAAAAGGCCCTTGACTACATCAAAAATGG
A
GTGGACGTCAACATCTGTAACCAGAATGGATTGAATGCACTCCATCTTGCTTCCAAAGAAGGCCATGTG
GAA
GTGGTCTCTGAGCTGCTGCAGAGGGAAGCCAATGTTGATGCCGCCACAAAGAAAGGAAACACGGCCT
TA
CACATCGCATCTTTGGCTGGGCAAGCGGAAGTGGTCAAGGTCTTGGTTACGAACGGAGCGAATGTCAA
C
GCACAATCTCAGAATGGCTTCACACCATTGTATATGGCAGCCCAGGAGAACCACCTGGAAGTCGTCAGG
TTT
CTTCTGGACAATGGCGCCAGCCAAAGCCTGGCCACAGAGGACGGCTTCACGCCATTGGCCGTGGCTC
TG
CAACAAGGTCATGACCAAGTCGTGTCCCTCCTGCTCGAGAACGACACGAAGGGAAAAGTGCGCCTCCC
A
GCCCTCCACATCGCAGCCCGGAAAGACGACACCAAGGCAGCAGCTCTGCTCCTGCAGAATGACACAAAC
GCG
GACGTGGAGTCAAAGAGTGGCTTCACCCCGCTCCACATAGCTGCCCACTATGGGAACATCAATGTGG
CC
ACGTTGCTGTTAAACCGAGCGGCTGCTGTGGACTTCACCGCACGGAATGACATCACTCCCTTACACGT
T
GCCTCGAAGCGAGGAAATGCAAATATGGTGAAGCTATTGCTGGACCGGGGTGCGAAGATCGATGCCAAG
ACC
AGGGACGGTCTGACTCCGTTGCACTGTGGGGCGAGAAGTGGCCATGAGCAGGTGGTAGAGATGTTGC
TT
GACAGATCCGCCCCCATCCTTTCAAAAACCAAGAATGGATTGTCGCCACTGCACATGGCCACACAAGG
A
GACCATTTAAACTGCGTCCAACTCCTCCTCCAGCACAACGTGCCCGTGGACGACGTCACCAACGACTAC
CTG
ACTGCCCTCCATGTGGCTGCCCACTGCGGCCATTACAAAGTTGCCAAGGTTCTTTTGGATAAGAAAG
CT
AGCCCCAATGCCAAAGCCCTGAATGGCTTCACCCCTCTCCATATCGCCTGCAAAAAGAACCGCATCCG
A
GTAATGGAACTCCTTTTGAAGCACGGTGCATCTATTCAAGCCGTAACCGAGTCGGGCCTTACCCCAATC
CAT
GTTGCTGCCTTCATGGGACATGTAAATATCGTGTCACAGCTAATGCATCATGGAGCCTCCCCAAACA
CC
ACCAATGTGAGAGGAGAGACGGCATTGCATATGGCGGCTCGGTCCGGACAAGCAGAAGTGGTGCGGTA
T
CTGGTCCAAGATGGGGCTCAGGTAGAAGCAAAAGCTAAGGATGACCAGACTCCACTCCACATCTCAGCC
CGA
CTTGGGAAAGCTGACATAGTGCAACAACTGTTACAGCAAGGAGCATCCCCCAATGCAGCAACAACTT
CT
GGGTACACCCCCCTTCACCTTGCGGCCAGAGAGGGGCATGAGGATGTAGCTGCGTTCCTCCTGGATCA
T
GGAGCATCTTTATCCATAACAACAAAGAAGGGATTCACCCCTCTGCACGTGGCAGCCAAATACGGAAAG
CTT
GAAGTCGCAAGTCTCCTGCTGCAGAAGAGTGCGTCTCCCGATGCCGCAGGGAAGAGCGGGCTAACTC
CA
CTGCATGTAGCAGCGCATTACGATAATCAGAAAGTGGCCCTTCTGCTCTTGGACCAGGGAGCCTCACC
C
CACGCAGCCGCAAAGAATGGCTATACACCACTGCACATCGCGGCCAAGAAGAACCAGATGGACATAGCC
ACG
TCCCTGCTGGAGTACGGTGCTGATGCAAACGCGGTTACCCGGCAAGGGATTGCGTCCGTCCATCTTG
CG
GCACAGGAAGGGCACGTGGACATGGTGTCGCTGCTCCTGAGTAGAAACGCGAATGTCAACCTGAGCAA
T
AAGAGCGGTCTCACCCCACTCCACCTGGCTGCTCAAGAAGACCGAGTGAATGTGGCCGAGGTCCTTGTC
AAC
CAGGGGGCCCATGTGGATGCTCAGACAAAGATGGGCTACACCCCGCTCCATGTGGGCTGTCACTATG
GA
AATATCAAAATAGTCAATTTTCTGCTGCAGCATTCTGCAAAAGTTAATGCCAAGACGAAGAATGGATA
C
ACAGCACTGCACCAGGCTGCTCAGCAGGGCCACACGCATATCATCAATGTCTTGCTTCAGAACAACGCC
TCC
CCCAATGAACTCACTGTGAATGGGAACACAGCTCTGGCCATCGCCCGGCGCCTTGGTTACATCTCGG
TG
GTTGACACACTGAAGGTCGTGACGGAGGAAATTATGACCACCACTACCATCACGGAGAAGCACAAAAT
G
AATGTCCCAGAAACGATGAATGAAGTCCTCGATATGTCAGACGATGAAGGTGAAGATGCCATCACAGGG
GAC
ACTGACAAGTATCTCGGGCCACAGGACCTTAAGGAGCTAGGTGATGACTCCCTGCCAGCAGAAGGTT
AC
GTAGGCTTCAGTCTTGGAGCCCGTTCTGCCAGCCTCCGCTCCTTCAGTTCGGATAGGTCCTACACCTT
G
AACAGAAGCTCCTACGCAAGGGACAGCATGATGATAGAGGAACTTCTGGTACCATCCAAAGAGCAGCAC
CTG
ACGTTCACGAGGGAGTTTGATTCTGACTCCCTCAGACACTACAGTTGGGCAGCGGACACGTTAGATA
AT
GTGAACCTGGTCTCAAGCCCGGTGCATTCTGGGTTTCTGGTTAGCTTTATGGTGGACGCGAGAGGGGG
C
TCCATGCGAGGAAGCCGCCACCACGGGATGCGGATCATCATCCCTCCGCGAAAGTGTACGGCCCCCACC
CGC
ATCACGTGCCGCCTGGTAAAGAGACATAAACTGGCCAACCCACCCCCCATGGTGGAAGGAGAGGGAT
TA
GCCAGTAGGCTGGTAGAAATGGGTCCTGCGGGGGCACAATTTTTAGGCCCCGTCATTGTGGAAATCCC
T
CATTTTGGGTCCATGAGGGGGAAGGAGAGAGAACTTATCGTCCTTCGGAGCGAGAACGGAGAGACCTGG
AAG
GAACATCAGTTTGACAGTAAAAACGAAGACCTCGCGGAGCTTCTCAATGGCATGGATGAAGAACTCG
AC
AGCCCGGAAGAGTTGGGTACAAAGCGCATCTGCAGAATTATCACAAAGGATTTCCCCCAGTATTTTGC
C
GTGGTTTCCCGGATTAAGCAGGAAAGCAACCAGATCGGTCCTGAGGGTGGGATTCTGAGCAGCACCACC
GTG
CCCCTCGTCCAGGCCTCCTTCCCAGAGGGCGCCTTAACCAAGAGGATCCGTGTGGGTCTCCAGGCTC
AG
CCCGTGCCAGAGGAAACGGTAAAAAAAATCCTTGGGAACAAAGCAACATTTAGCCCAATTGTCACGGT
A
GAGCCGAGGAGAAGGAAGTTCCATAAGCCGATCACCATGACCATTCCGGTGCCCCCGCCCTCGGGAGAA
GGC
GTGTCCAATGGGTACAAGGGGGATGCCACGCCCAACCTGCGGCTCCTCTGCAGCATCACAGGAGGCA
CC
TCACCAGCTCAATGGGAAGACATCACAGGAACAACCCCTCTGACGTTCATAAAGGATTGTGTGTCTTT
C
ACAACCAACGTTTCAGCCAGATTCTGGCTGGCGGACTGCCATCAGGTGTTAGAGACCGTAGGGCTAGCC
TCC
CAGCTGTACAGAGAGCTGATATGCGTTCCCTACATGGCCAAGTTCGTTGTGTTTGCCAAAACAAACG
AC
CCGGTGGAGTCCTCGCTGAGGTGCTTCTGTATGACAGACGACAGGGTGGACAAAACCCTGGAGCAGCA
G
GAGAACTTCGAGGAGGTTGCCAGAAGCAAAGACATTGAGGTTCTGGAAGGAAAGCCCATCTACGTTGAT
TGC
TATGGAAACCTGGCCCCTCTGACCAAAGGAGGACAGCAGCTTGTTTTTAACTTTTATTCTTTCAAAG
AA
AACAGACTGCCATTTTCCATCAAGATCAGAGACACCAGTCAAGAGCCCTGTGGCCGCCTGTCTTTCCT
G
AAGGAGCCAAAGACAACAAAGGGATTACCCCAAACAGCTGTTTGCAACTTAAATATTACTCTGCCGGCA
CAT
AAAAAGGCTGAGAAGGCAGACAGACGCCAGAGCTTTGCCTCCCTAGCTTTACGTAAGCGCTACAGCT
AC
TTGACTGAACCCAGCATGAGTCCGCAGAGTCCTTGTGAGCGGACGGATATCAGGATGGCGATAGTAGC
C
GATCACCTGGGACTTAGTTGGACAGAGCTGGCAAGGGAACTGAATTTTTCAGTGGATGAAATCAACCAA
ATA
CGTGTGGAAAATCCCAATTCTTTAATTTCTCAGAGCTTCATGTTATTAAAAAAGTGGGTGACCAGAG
AC
GGAAAGAATGCCACAACTGATGCCTTAACTTCGGTCTTAACGAAGATTAACCGGATAGACATTGTAAC
T
CTGCTGGAAGGACCAATATTTGATTATGGGAATATTTCAGGCACCAGAAGCTTTGCAGATGAAAACAAT
GTT
TTCCATGACCCAGTTGATGGTTGGCAGAACGAGACGCCAAGTGGAAGCCTAGAGTCCCCAGCGCAAG
CT
CGAAGACTAACTGGTGGGTTACTGGACCGTCTGGATGACAGCTCTGACCAGGCTCGGGATTCTATTAC
C
TCATACCTCACGGGAGAACCTGGGAAGATCGAAGCAAATGGAAACCACACAGCGGAAGTCATTCCAGAA
GCA
AAGGCAAAACCCTACTTCCCGGAATCCCAAAACGATATAGGGAAACAGAGCATCAAGGAGAACCTGA
AA
CCAAAAACACACGGATGTGGTCGCACTGAGGAACCAGTGTCGCCCCTCACAGCCTACCAGAAATCTCT
G
GAAGAAACCAGCAAGCTTGTCATAGAAGACGCACCTAAACCCTGTGTGCCTGTCGGCATGAAAAAGATG
ACC
AGGACTACGGCTGACGGCAAAGCCAGGCTCAACCTCCAGGAAGAAGAGGGGTCCACCAGGTCAGAGC
CT
AAGCAGGGAGAAGGCTATAAGGTGAAGACGAAGAAGGAAATCCGGAACGTGGAGAAGAAAACCCACTA
G


Translation (1726 aa):
MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHV
E
VVSELLQREANVDAATK
KGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVR
F
LLDNGASQSLATE
DGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTN
A
DVESK
SGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAK
T
R
DGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDY
L
TALHVAAHCGHYKVAKVLLDKKASPNAKAL
NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPI
H
VAAFMGHVNIVSQLMHHGASPNTTNV
RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISA
R
LGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTK
KGFTPLHVAAKYGK
L
EVASLLLQKSASPDAAGK
SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIA
T
SLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK
SGLTPLHLAAQEDRVNVAEVLV
N
QGAHVDAQTK
MGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA
S
PNELTV
NGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITG
D
TDKYLGPQDLKELGDDSLPAEGYVGFSLGARSA
SLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQH
L
TFTREFDSDSLRHYSWAADTLDNVNLVSSPVHS
GFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPT
R
ITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFL
GPVIVEIPHFGSMRGKERELIVLRSENGETW
K
EHQFDSKNEDLAELLNGMDE
ELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTT
V
PLVQASFPEGALTKRIRVGLQ
AQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGE
G
VSNGYKGDATPNLRLLCSIT
GGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLA
S
QLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIE
VLEGKPIYVD
C
YGNLAPLTKGGQQLVFNFYSFKENRLPFSIK
IRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPA
H
KK
AEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQ
I
RVENPNSLISQSFMLLKKWVTRDGKNAT
TDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENN
V
FHDPVD
GWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANGNHTAEVIPE
A
KAKPYFPESQNDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKM
T
RTTADGKARLNLQEEEGSTRSEPK
QGEGYKVKTKKEIRNVEKKTH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser