NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS59314.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59314.1 Public Homo sapiens 18 DTNA 22 109 92 CCDS HistoryNCBI Gene:1837Re-query CCDS DB by CCDS ID:59314.1Re-query CCDS DB by GeneID:1837See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 12, NCBI annotation release 104, Ensembl annotation release 71

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59314.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000597674.5 ENSP00000471783.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000597674.5Link to Ensembl Protein Viewer:ENSP00000471783.1Re-query CCDS DB by Nucleotide ID:ENST00000597674Re-query CCDS DB by Protein ID:ENSP00000471783
Original member NCBI NM_032981.4 NP_116763.1 Updated not alive Link to Nucleotide Sequence:NM_032981.4Link to Protein Sequence:NP_116763.1Re-query CCDS DB by Nucleotide ID:NM_032981Re-query CCDS DB by Protein ID:NP_116763
Current member NCBI NM_032981.5 NP_116763.1 Accepted alive Link to Nucleotide Sequence:NM_032981.5Link to Protein Sequence:NP_116763.1Re-query CCDS DB by Nucleotide ID:NM_032981Re-query CCDS DB by Protein ID:NP_116763Link to BLAST:NP_116763.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_116763.1 192 Q9Y4J8-8 192 100% 0 0

Chromosomal Locations for CCDS 59314.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 34820869 34820915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34827593 34827676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34848296 34848383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34851831 34851928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34858285 34858398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34863966 34864062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34866111 34866161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (579 nt):
ATGTTCCCAGATCAGCCTGAGAAGCCACTCAACTTGGCTCACATCGTGCCTCCCAGACCTGTAACCAGCA
TG
AACGACACCCTGTTCTCCCACTCTGTTCCCTCCTCAGGAAGTCCTTTTATTACCAGGAGCATGCTTGA
G
AGTTCAAACCGGCTTGATGAAGAACACAGGCTAATTGCCAGGTATGCGGCAAGGCTGGCAGCAGAGTCC
TCT
TCGTCTCAGCCACCTCAGCAGAGAAGTGCTCCTGACATCTCTTTCACCATCGATGCGAATAAGCAGC
AA
AGGCAGCTGATTGCTGAGCTAGAAAACAAGAACAGAGAAATCTTACAGGAGATCCAGAGACTTCGGCT
A
GAGCATGAACAAGCTTCTCAGCCCACGCCAGAGAAGGCACAGCAAAACCCCACCCTGCTGGCAGAACTC
CGG
CTCCTCAGACAGCGCAAAGATGAGCTGGAACAGAGAATGTCTGCTCTCCAGGAGAGCCGGAGAGAGC
TA
ATGGTCCAGTTGGAGGGTCTCATGAAGCTACTAAAGGAAGAAGAACTGAAGCAGGGAGTAAGTTATGT
C
CCCTACTGCAGGTCTTAA


Translation (192 aa):
MFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSMLESSNRLDEEHRLIARYAARLAAES
S
SS
QPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAEL
R
LL
RQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGVSYVPYCRS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser