NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS58263.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58263.1 Public Homo sapiens 12 NDUFA12 22 109 92 CCDS HistoryNCBI Gene:55967Re-query CCDS DB by CCDS ID:58263.1Re-query CCDS DB by GeneID:55967See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58263.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000547986.5 ENSP00000450130.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000547986.5Link to Ensembl Protein Viewer:ENSP00000450130.1Re-query CCDS DB by Nucleotide ID:ENST00000547986Re-query CCDS DB by Protein ID:ENSP00000450130
Original member Current member NCBI NM_001258338.1 NP_001245267.1 Accepted alive Link to Nucleotide Sequence:NM_001258338.1Link to Protein Sequence:NP_001245267.1Re-query CCDS DB by Nucleotide ID:NM_001258338Re-query CCDS DB by Protein ID:NP_001245267Link to BLAST:NP_001245267.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001245267.1 63 Q9UI09-2 63 100% 0 0

Chromosomal Locations for CCDS 58263.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 94971598 94971620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 95002739 95002821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 95003595 95003680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (192 nt):
ATGGAGTTAGTGCAGGTCCTGAAACGCGGGCTGCAGCAGATCACCGGCCACGGCGGTCTCCGAGGCTATC
TA
CGGGTTTTTTTCAGGACAAATGATGCGAAGGTTGGTACATTAGTGGGGGAAGACAAATATGGAAACAA
A
TACTATGAAGACAACAAGCAATTTTTTGGCATCGTTGGCTTCACAGTATGA


Translation (63 aa):
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGIVGFTV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser