NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58135.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58135.1 Public Homo sapiens 11 MS4A4A 22 109 92 CCDS HistoryNCBI Gene:51338Re-query CCDS DB by CCDS ID:58135.1Re-query CCDS DB by GeneID:51338See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58135.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000532114.5 ENSP00000434506.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000532114.5Link to Ensembl Protein Viewer:ENSP00000434506.1Re-query CCDS DB by Nucleotide ID:ENST00000532114Re-query CCDS DB by Protein ID:ENSP00000434506
Original member NCBI NM_001243266.1 NP_001230195.1 Updated not alive Link to Nucleotide Sequence:NM_001243266.1Link to Protein Sequence:NP_001230195.1Re-query CCDS DB by Nucleotide ID:NM_001243266Re-query CCDS DB by Protein ID:NP_001230195
Current member NCBI NM_001243266.2 NP_001230195.1 Accepted alive Link to Nucleotide Sequence:NM_001243266.2Link to Protein Sequence:NP_001230195.1Re-query CCDS DB by Nucleotide ID:NM_001243266Re-query CCDS DB by Protein ID:NP_001230195Link to BLAST:NP_001230195.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001230195.1 186 Q96JQ5-2 186 100% 0 0

Chromosomal Locations for CCDS 58135.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 60280676 60280716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 60292225 60292384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 60297197 60297325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 60301001 60301057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 60306100 60306201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 60308107 60308178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (561 nt):
ATGCATCAGACCTACAGCAGACATTGCAGGCCTGAAGAAAGCACCTTTTCTGCTGCCATGACAACCATGC
AA
GGAATGGAACAGGCCATGCCAGGGGCTGGCCCTGGTGTGCCCCAGCTGGGAAACATGGCTGTCATACA
T
TCACATCTGTGGAAAGGATTGCAAGAGAAGTTCTTGAAGGGAGAACCCAAAGTCCTTGGGGTTGTGCAG
ATT
CTGACTGCCCTGATGAGCCTTAGCATGGGAATAACAATGATGTGTATGGCATCTAATACTTATGGAA
GT
AACCCTATTTCCGTGTATATCGGGTACACAATTTGGGGGTCAGTAATGTTTATTATTTCAGGATCCTT
G
TCAATTGCAGCAGGAATTAGAACTACAAAAGGCCTGGGTCTGGATGGCATGGTGCTCCTCCTAAGTGTG
CTG
GAATTCTGCATTGCTGTGTCCCTCTCTGCCTTTGGATGTAAAGTGCTCTGTTGTACCCCTGGTGGGG
TT
GTGTTAATTCTGCCATCACATTCTCACATGGCAGAAACAGCATCTCCCACACCACTTAATGAGGTTTG
A


Translation (186 aa):
MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHLWKGLQEKFLKGEPKVLGVVQ
I
LTALMSLSMGITMMCMASNTYGSNPISVYIGYTIWGSVM
FIISGSLSIAAGIRTTKGLGLDGMVLLLSV
L
EFCIAVSLSAFGCKVLCCTPGG
VVLILPSHSHMAETASPTPLNEV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser