NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58006.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58006.1 Public Homo sapiens 1 IL12RB2 22 109 92 CCDS HistoryNCBI Gene:3595Re-query CCDS DB by CCDS ID:58006.1Re-query CCDS DB by GeneID:3595See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58006.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000371000.5 ENSP00000360039.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000371000.5Link to Ensembl Protein Viewer:ENSP00000360039.1Re-query CCDS DB by Nucleotide ID:ENST00000371000Re-query CCDS DB by Protein ID:ENSP00000360039
Original member Current member NCBI NM_001258214.1 NP_001245143.1 Accepted alive Link to Nucleotide Sequence:NM_001258214.1Link to Protein Sequence:NP_001245143.1Re-query CCDS DB by Nucleotide ID:NM_001258214Re-query CCDS DB by Protein ID:NP_001245143Link to BLAST:NP_001245143.1
Original member Current member NCBI NM_001319233.1 NP_001306162.1 Accepted alive Link to Nucleotide Sequence:NM_001319233.1Link to Protein Sequence:NP_001306162.1Re-query CCDS DB by Nucleotide ID:NM_001319233Re-query CCDS DB by Protein ID:NP_001306162Link to BLAST:NP_001306162.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001245143.1 659 Q99665-2 659 100% 0 0
NP_001306162.1 659 Q99665-2 659 100% 0 0

Chromosomal Locations for CCDS 58006.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 67320369 67320444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67321602 67321889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67326735 67326849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67328200 67328384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67329587 67329729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67330660 67330810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67338624 67338703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67350870 67351089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67367825 67368025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67372436 67372534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67372625 67372783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67379986 67380123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67386579 67386669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 67395547 67395580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1980 nt):
ATGGCACATACTTTTAGAGGATGCTCATTGGCATTTATGTTTATAATCACGTGGCTGTTGATTAAAGCAA
AA
ATAGATGCGTGCAAGAGAGGCGATGTGACTGTGAAGCCTTCCCATGTAATTTTACTTGGATCCACTGT
C
AATATTACATGCTCTTTGAAGCCCAGACAAGGCTGCTTTCACTATTCCAGACGTAACAAGTTAATCCTG
TAC
AAGTTTGACAGAAGAATCAATTTTCACCATGGCCACTCCCTCAATTCTCAAGTCACAGGTCTTCCCC
TT
GGTACAACCTTGTTTGTCTGCAAACTGGCCTGTATCAATAGTGATGAAATTCAAATATGTGGAGCAGA
G
ATCTTCGTTGGTGTTGCTCCAGAACAGCCTCAAAATTTATCCTGCATACAGAAGGGAGAACAGGGGACT
GTG
GCCTGCACCTGGGAAAGAGGACGAGACACCCACTTATACACTGAGTATACTCTACAGCTAAGTGGAC
CA
AAAAATTTAACCTGGCAGAAGCAATGTAAAGACATTTATTGTGACTATTTGGACTTTGGAATCAACCT
C
ACCCCTGAATCACCTGAATCCAATTTCACAGCCAAGGTTACTGCTGTCAATAGTCTTGGAAGCTCCTCT
TCA
CTTCCATCCACATTCACATTCTTGGACATAGTGAGGCCTCTTCCTCCGTGGGACATTAGAATCAAAT
TT
CAAAAGGCTTCTGTGAGCAGATGTACCCTTTATTGGAGAGATGAGGGACTGGTACTGCTTAATCGACT
C
AGATATCGGCCCAGTAACAGCAGGCTCTGGAATATGGTTAATGTTACAAAGGCCAAAGGAAGACATGAT
TTG
CTGGATCTGAAACCATTTACAGAATATGAATTTCAGATTTCCTCTAAGCTACATCTTTATAAGGGAA
GT
TGGAGTGATTGGAGTGAATCATTGAGAGCACAAACACCAGAAGAAGAGCCTACTGGGATGTTAGATGT
C
TGGTACATGAAACGGCACATTGACTACAGTAGACAACAGATTTCTCTTTTCTGGAAGAATCTGAGTGTC
TCA
GAGGCAAGAGGAAAAATTCTCCACTATCAGGTGACCTTGCAGGAGCTGACAGGAGGGAAAGCCATGA
CA
CAGAACATCACAGGACACACCTCCTGGACCACAGTCATTCCTAGAACCGGAAATTGGGCTGTGGCTGT
G
TCTGCAGCAAATTCAAAAGGCAGTTCTCTGCCCACTCGTATTAACATAATGAACCTGTGTGAGGCAGGG
TTG
CTGGCTCCTCGCCAGGTCTCTGCAAACTCAGAGGGCATGGACAACATTCTGGTGACTTGGCAGCCTC
CC
AGGAAAGATCCCTCTGCTGTTCAGGAGTACGTGGTGGAATGGAGAGAGCTCCATCCAGGGGGTGACAC
A
CAGGTCCCTCTAAACTGGCTACGGAGTCGACCCTACAATGTGTCTGCTCTGATTTCAGAGAACATAAAA
TCC
TACATCTGTTATGAAATCCGTGTGTATGCACTCTCAGGGGATCAAGGAGGATGCAGCTCCATCCTGG
GT
AACTCTAAGCACAAAGCACCACTGAGTGGCCCCCACATTAATGCCATCACAGAGGAAAAGGGGAGCAT
T
TTAATTTCATGGAACAGCATTCCAGTCCAGGAGCAAATGGGCTGCCTCCTCCATTATAGGATATACTGG
AAG
GAACGGGACTCCAACTCCCAGCCTCAGCTCTGTGAAATTCCCTACAGAGTCTCCCAAAATTCACATC
CA
ATAAACAGCCTGCAGCCCCGAGTGACATATGTCCTGTGGATGACAGCTCTGACAGCTGCTGGTGAAAG
T
TCCCACGGAAATGAGAGGGAATTTTGTCTGCAAGGTAAAGCCAATTGGATGGCGTTTGTGGCACCAAGC
ATT
TGCATTGCTATCATCATGGTGGGCATTTTCTCAACGCATTACTTCCAGCAAAAGAGAAGACACAGCT
GC
CCTTGGACAGGCTCCTGA


Translation (659 aa):
MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLIL
Y
KFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVG
VAPEQPQNLSCIQKGEQGT
V
ACTWERGRDTHLYTEYTL
QLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSS
S
LPSTFTFLDI
VRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHD
L
LDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEE
EPTGMLDVWYMKRHIDYSRQQISLFWKNLSV
S
EARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEA
G
L
LAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALIS
ENIK
S
YICYEIRVYALSGDQGGCSSILGNSKHK
APLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYW
K
ERDSNSQPQLC
EIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPS
I
CIAIIMVGIFSTHYFQQ
KRRHSCPWTGS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser