NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS573.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
573.1 Public Homo sapiens 1 PODN 22 109 92 CCDS HistoryNCBI Gene:127435Re-query CCDS DB by CCDS ID:573.1Re-query CCDS DB by GeneID:127435See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 573.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000312553.9 ENSP00000308315.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000312553.9Link to Ensembl Protein Viewer:ENSP00000308315.5Re-query CCDS DB by Nucleotide ID:ENST00000312553Re-query CCDS DB by Protein ID:ENSP00000308315
Original member Current member NCBI NM_153703.4 NP_714914.2 Accepted alive Link to Nucleotide Sequence:NM_153703.4Link to Protein Sequence:NP_714914.2Re-query CCDS DB by Nucleotide ID:NM_153703Re-query CCDS DB by Protein ID:NP_714914Link to BLAST:NP_714914.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_714914.2 661 Q7Z5L7-3 661 100% 0 0

Chromosomal Locations for CCDS 573.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 53062220 53062308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53069801 53070167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53071535 53071628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53074606 53074670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53075862 53075971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53077190 53077346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53077685 53077800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53078365 53079022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53080728 53080876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53081981 53082161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1986 nt):
ATGGAAGGAGCCCGAGCCCGCGGAGCGCAGCTGAGACTGGGGGAGCGCGTTCGGCCTGTGGGGCGCCGCT
CG
GCGCCGGGGCGCAGCAGGTTCCGTCAGCCCTGGCGCCCAGGCGCATCTGACTCGGCACCCCCTGCAGG
C
ACCATGGCCCAGAGCCGGGTGCTGCTGCTCCTGCTGCTGCTGCCGCCACAGCTGCACCTGGGACCTGTG
CTT
GCCGTGAGGGCCCCAGGATTTGGCCGAAGTGGCGGCCACAGCCTGAGCCCCGAAGAGAACGAATTTG
CG
GAGGAGGAGCCGGTGCTGGTACTGAGCCCTGAGGAGCCCGGGCCTGGCCCAGCCGCGGTCAGCTGCCC
C
CGAGACTGTGCCTGTTCCCAGGAGGGCGTCGTGGACTGTGGCGGTATTGACCTGCGTGAGTTCCCGGGG
GAC
CTGCCTGAGCACACCAACCACCTATCTCTGCAGAACAACCAGCTGGAAAAGATCTACCCTGAGGAGC
TC
TCCCGGCTGCACCGGCTGGAGACGCTGAACCTGCAAAACAACCGCCTGACTTCCCGAGGGCTCCCAGA
G
AAGGCGTTTGAGCATCTGACCAACCTCAATTACCTGTACTTGGCCAATAACAAGCTGACCTTGGCACCC
CGC
TTCCTGCCAAACGCCCTGATCAGTGTGGACTTTGCTGCCAACTATCTCACCAAGATCTATGGGCTCA
CC
TTTGGCCAGAAGCCAAACTTGAGGTCTGTGTACCTGCACAACAACAAGCTGGCAGACGCCGGGCTGCC
G
GACAACATGTTCAACGGCTCCAGCAACGTCGAGGTCCTCATCCTGTCCAGCAACTTCCTGCGCCACGTG
CCC
AAGCACCTGCCGCCTGCCCTGTACAAGCTGCACCTCAAGAACAACAAGCTGGAGAAGATCCCCCCGG
GG
GCCTTCAGCGAGCTGAGCAGCCTGCGCGAGCTATACCTGCAGAACAACTACCTGACTGACGAGGGCCT
G
GACAACGAGACCTTCTGGAAGCTCTCCAGCCTGGAGTACCTGGATCTGTCCAGCAACAACCTGTCTCGG
GTC
CCAGCTGGGCTGCCGCGCAGCCTGGTGCTGCTGCACTTGGAGAAGAACGCCATCCGGAGCGTGGACG
CG
AATGTGCTGACCCCCATCCGCAGCCTGGAGTACCTGCTGCTGCACAGCAACCAGCTGCGGGAGCAGGG
C
ATCCACCCACTGGCCTTCCAGGGCCTCAAGCGGTTGCACACGGTGCACCTGTACAACAACGCGCTGGAG
CGC
GTGCCCAGTGGCCTGCCTCGCCGCGTGCGCACCCTCATGATCCTGCACAACCAGATCACAGGCATTG
GC
CGCGAAGACTTTGCCACCACCTACTTCCTGGAGGAGCTCAACCTCAGCTACAACCGCATCACCAGCCC
G
CAGGTGCACCGCGACGCCTTCCGCAAGCTGCGCCTGCTGCGCTCGCTGGACCTGTCGGGCAACCGGCTG
CAC
ACGCTGCCACCTGGGCTGCCTCGAAATGTCCATGTGCTGAAGGTCAAGCGCAATGAGCTGGCTGCCT
TG
GCACGAGGGGCGCTGGTGGGCATGGCTCAGCTGCGTGAGCTGTACCTCACCAGCAACCGACTGCGCAG
C
CGAGCCCTGGGCCCCCGTGCCTGGGTGGACCTCGCCCATCTGCAGCTGCTGGACATCGCCGGGAATCAG
CTC
ACAGAGATCCCCGAGGGGCTCCCCGAGTCACTTGAGTACCTGTACCTGCAGAACAACAAGATTAGTG
CG
GTGCCCGCCAATGCCTTCGACTCCACGCCCAACCTCAAGGGGATCTTTCTCAGGTTTAACAAGCTGGC
T
GTGGGCTCCGTGGTGGACAGTGCCTTCCGGAGGCTGAAGCACCTGCAGGTCTTGGACATTGAAGGCAAC
TTA
GAGTTTGGTGACATTTCCAAGGACCGTGGCCGCTTGGGGAAGGAAAAGGAGGAGGAGGAAGAGGAGG
AG
GAGGAGGAAGAGGAAACAAGATAG


Translation (661 aa):
MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTMAQSRVLLLLLLLPPQLHLGPV
L
AVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACSQEGVVDCGGIDLREFPG
D
LPEHTNHLSLQ
NNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAP
R
FLPNALISVDFAANYLTKIYGLTFGQKPNL
RSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHV
P
KHLPPALYKLHLK
NNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSR
V
PAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALE
R
VPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRL
H
TLPPGLPRNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQ
LLDIAGNQ
L
TEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFL
RFNKLAVGSVVDSAFRRLKHLQVLDIEGN
L
EFGDISKDRGRLGKEKEEEEEEEEEEEETR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser