NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5652.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5652.1 Public Homo sapiens 7 ASNS 22 109 92 CCDS HistoryNCBI Gene:440Re-query CCDS DB by CCDS ID:5652.1Re-query CCDS DB by GeneID:440See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5652.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000175506.8 ENSP00000175506.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000175506.8Link to Ensembl Protein Viewer:ENSP00000175506.4Re-query CCDS DB by Nucleotide ID:ENST00000175506Re-query CCDS DB by Protein ID:ENSP00000175506
Original member Current member EBI,WTSI ENST00000394308.7 ENSP00000377845.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394308.7Link to Ensembl Protein Viewer:ENSP00000377845.3Re-query CCDS DB by Nucleotide ID:ENST00000394308Re-query CCDS DB by Protein ID:ENSP00000377845
Original member Current member EBI,WTSI ENST00000394309.7 ENSP00000377846.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394309.7Link to Ensembl Protein Viewer:ENSP00000377846.3Re-query CCDS DB by Nucleotide ID:ENST00000394309Re-query CCDS DB by Protein ID:ENSP00000377846
Original member NCBI NM_001352496.1 NP_001339425.1 Updated not alive Link to Nucleotide Sequence:NM_001352496.1Link to Protein Sequence:NP_001339425.1Re-query CCDS DB by Nucleotide ID:NM_001352496Re-query CCDS DB by Protein ID:NP_001339425
Current member NCBI NM_001352496.2 NP_001339425.1 Accepted alive Link to Nucleotide Sequence:NM_001352496.2Link to Protein Sequence:NP_001339425.1Re-query CCDS DB by Nucleotide ID:NM_001352496Re-query CCDS DB by Protein ID:NP_001339425Link to BLAST:NP_001339425.1
Original member NCBI NM_001673.4 NP_001664.3 Updated not alive Link to Nucleotide Sequence:NM_001673.4Link to Protein Sequence:NP_001664.3Re-query CCDS DB by Nucleotide ID:NM_001673Re-query CCDS DB by Protein ID:NP_001664
Current member NCBI NM_001673.5 NP_001664.3 Accepted alive Link to Nucleotide Sequence:NM_001673.5Link to Protein Sequence:NP_001664.3Re-query CCDS DB by Nucleotide ID:NM_001673Re-query CCDS DB by Protein ID:NP_001664Link to BLAST:NP_001664.3
Original member Current member NCBI NM_133436.3 NP_597680.2 Accepted alive Link to Nucleotide Sequence:NM_133436.3Link to Protein Sequence:NP_597680.2Re-query CCDS DB by Nucleotide ID:NM_133436Re-query CCDS DB by Protein ID:NP_597680Link to BLAST:NP_597680.2
Original member Current member NCBI NM_183356.3 NP_899199.2 Accepted alive Link to Nucleotide Sequence:NM_183356.3Link to Protein Sequence:NP_899199.2Re-query CCDS DB by Nucleotide ID:NM_183356Re-query CCDS DB by Protein ID:NP_899199Link to BLAST:NP_899199.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001339425.1 561 P08243-1 561 100% 0 0
NP_001664.3 561 P08243-1 561 100% 0 0
NP_597680.2 561 P08243-1 561 100% 0 0
NP_899199.2 561 P08243-1 561 100% 0 0

Chromosomal Locations for CCDS 5652.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 97852259 97852468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97853060 97853215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97853305 97853386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97854580 97854680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97855353 97855459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97856690 97856816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97858278 97858405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97858854 97858955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97859213 97859398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97864259 97864496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 97868908 97869156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1686 nt):
ATGTGTGGCATTTGGGCGCTGTTTGGCAGTGATGATTGCCTTTCTGTTCAGTGTCTGAGTGCTATGAAGA
TT
GCACACAGAGGTCCAGATGCATTCCGTTTTGAGAATGTCAATGGATACACCAACTGCTGCTTTGGATT
T
CACCGGTTGGCGGTAGTTGACCCGCTGTTTGGAATGCAGCCAATTCGAGTGAAGAAATATCCGTATTTG
TGG
CTCTGTTACAATGGTGAAATCTACAACCATAAGAAGATGCAACAGCATTTTGAATTTGAATACCAGA
CC
AAAGTGGATGGTGAGATAATCCTTCATCTTTATGACAAAGGAGGAATTGAGCAAACAATTTGTATGTT
G
GATGGTGTGTTTGCATTTGTTTTACTGGATACTGCCAATAAGAAAGTGTTCCTGGGTAGAGATACATAT
GGA
GTCAGACCTTTGTTTAAAGCAATGACAGAAGATGGATTTTTGGCTGTATGTTCAGAAGCTAAAGGTC
TT
GTTACATTGAAGCACTCCGCGACTCCCTTTTTAAAAGTGGAGCCTTTTCTTCCTGGACACTATGAAGT
T
TTGGATTTAAAGCCAAATGGCAAAGTTGCATCCGTGGAAATGGTTAAATATCATCACTGTCGGGATGTA
CCC
CTGCACGCCCTCTATGACAATGTGGAGAAACTCTTTCCAGGTTTTGAGATAGAAACTGTGAAGAACA
AC
CTCAGGATCCTTTTTAATAATGCTGTAAAGAAACGTTTGATGACAGACAGAAGGATTGGCTGCCTTTT
A
TCAGGGGGCTTGGACTCCAGCTTGGTTGCTGCCACTCTGTTGAAGCAGCTGAAAGAAGCCCAAGTACAG
TAT
CCTCTCCAGACATTTGCAATTGGCATGGAAGACAGCCCCGATTTACTGGCTGCTAGAAAGGTGGCAG
AT
CATATTGGAAGTGAACATTATGAAGTCCTTTTTAACTCTGAGGAAGGCATTCAGGCTCTGGATGAAGT
C
ATATTTTCCTTGGAAACTTATGACATTACAACAGTTCGTGCTTCAGTAGGTATGTATTTAATTTCCAAG
TAT
ATTCGGAAGAACACAGATAGCGTGGTGATCTTCTCTGGAGAAGGATCAGATGAACTTACGCAGGGTT
AC
ATATATTTTCACAAGGCTCCTTCTCCTGAAAAAGCCGAGGAGGAGAGTGAGAGGCTTCTGAGGGAACT
C
TATTTGTTTGATGTTCTCCGCGCAGATCGAACTACTGCTGCCCATGGTCTTGAACTGAGAGTCCCATTT
CTA
GATCATCGATTTTCTTCCTATTACTTGTCTCTGCCACCAGAAATGAGAATTCCAAAGAATGGGATAG
AA
AAACATCTCCTGAGAGAGACGTTTGAGGATTCCAATCTGATACCCAAAGAGATTCTCTGGCGACCAAA
A
GAAGCCTTCAGTGATGGAATAACTTCAGTTAAGAATTCCTGGTTTAAGATTTTACAGGAATACGTTGAA
CAT
CAGGTTGATGATGCAATGATGGCAAATGCAGCCCAGAAATTTCCCTTCAATACTCCTAAAACCAAAG
AA
GGATATTACTACCGTCAAGTCTTTGAACGCCATTACCCAGGCCGGGCTGACTGGCTGAGCCATTACTG
G
ATGCCCAAGTGGATCAATGCCACTGACCCTTCTGCCCGCACGCTGACCCACTACAAGTCAGCTGTCAAA
GCT
TAG


Translation (561 aa):
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL
W
LCYNGEIYNHKK
MQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY
G
VRPLFKAMTEDGFLAVCSEAK
GLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV
P
LHALYDNVEKLFP
GFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ
Y
PLQTFAIGMEDSPDLLAARK
VADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK
Y
IRKNTDSVVIFSGEGSDELTQGYIYFHK
APSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
L
DHRFSSYYLSLPPEMRIPK
NGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE
H
Q
VDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK
A




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser