NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS56492.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56492.1 Public Homo sapiens 7 GTF2IRD1 22 109 92 CCDS HistoryNCBI Gene:9569Re-query CCDS DB by CCDS ID:56492.1Re-query CCDS DB by GeneID:9569See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56492.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000455841.6 ENSP00000397566.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000455841.6Link to Ensembl Protein Viewer:ENSP00000397566.2Re-query CCDS DB by Nucleotide ID:ENST00000455841Re-query CCDS DB by Protein ID:ENSP00000397566
Original member NCBI NM_001199207.1 NP_001186136.1 Updated not alive Link to Nucleotide Sequence:NM_001199207.1Link to Protein Sequence:NP_001186136.1Re-query CCDS DB by Nucleotide ID:NM_001199207Re-query CCDS DB by Protein ID:NP_001186136
Current member NCBI NM_001199207.2 NP_001186136.1 Accepted alive Link to Nucleotide Sequence:NM_001199207.2Link to Protein Sequence:NP_001186136.1Re-query CCDS DB by Nucleotide ID:NM_001199207Re-query CCDS DB by Protein ID:NP_001186136Link to BLAST:NP_001186136.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186136.1 976 Q9UHL9-3 976 100% 0 0

Chromosomal Locations for CCDS 56492.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 74508081 74508203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74512830 74512971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74515345 74515596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74518139 74518322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74519409 74519719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74521208 74521297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74524071 74524154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74529734 74529917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74535113 74535138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74536167 74536275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74538136 74538173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74538680 74538760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74539879 74539968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74544755 74544802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74545744 74545809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74547103 74547286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74555174 74555223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74555438 74555494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74557639 74557722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74558861 74559044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74559627 74559655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74589851 74589928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74590825 74591017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74595014 74595051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74601044 74601180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74602365 74602433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2931 nt):
ATGGCCTTGCTGGGTAAGCGCTGTGACGTCCCCACCAACGGCTGCGGACCCGACCGCTGGAACTCCGCGT
TC
ACCCGCAAAGACGAGATCATCACCAGCCTCGTGTCTGCCTTAGACTCCATGTGCTCAGCGCTGTCCAA
A
CTGAACGCCGAGGTGGCCTGTGTCGCCGTGCACGATGAGAGCGCCTTTGTGGTGGGCACAGAGAAGGGG
AGA
ATGTTCCTGAATGCCCGGAAGGAGCTACAGTCAGACTTCCTCAGGTTCTGCCTCTCCGCAGCTCAGC
AC
AGGGCAGCGACATCCCAGCTCGAAGGCCGGGTGGTGAGACGGGTGCTCACTGTGGCCTCGCGTGCTCT
G
TGTCCCACAGGAGGGCCCCCGTGGAAGGATCCGGAGGCAGAGCACCCCAAGAAGGTGCAGCGGGGCGAG
GGT
GGAGGCCGTAGCCTCCCTCGGTCCTCCCTGGAACATGGCTCAGATGTGTACCTTCTGCGGAAGATGG
TA
GAGGAGGTGTTTGATGTTCTTTATAGCGAGGCCCTGGGAAGGGCCAGTGTGGTGCCACTGCCCTATGA
G
AGGCTGCTCAGGGAGCCAGGGCTGCTGGCCGTGCAGGGGCTGCCCGAAGGCCTGGCCTTCCGAAGGCCA
GCC
GAGTATGACCCCAAGGCCCTCATGGCCATCCTGGAACACAGCCACCGCATCCGCTTCAAGCTCAAGA
G
G
CCACTTGAGGATGGCGGGCGGGACTCGAAGGCCCTGGTGGAGCTGAACGGTGTCTCCCTGATTCCCAA
G
GGGTCACGGGACTGTGGCCTGCATGGCCAGGCCCCCAAGGTGCCACCCCAGGACCTGCCCCCAACCGCC
ACC
TCCTCCTCCATGGCCAGCTTCCTGTACAGCACGGCGCTCCCCAACCACGCCATCCGAGAGCTCAAGC
AG
GAAGCACCTTCCTGCCCCCTTGCCCCCAGCGACCTGGGCCTGAGTCGGCCCATGCCAGAGCCCAAGGC
C
ACCGGTGCCCAAGACTTCTCCGACTGTTGTGGACAGAAGCCCACTGGGCCTGGTGGGCCTCTCATCCAG
AAC
GTCCATGCCTCCAAGCGCATTCTCTTCTCCATCGTCCATGACAAGTCAGAGAAGTGGGACGCCTTCA
TA
AAGGAAACCGAGGACATCAACACGCTCCGGGAGTGTGTGCAGATCCTGTTTAACAGCAGATATGCGGA
A
GCCCTGGGCCTGGACCACATGGTCCCCGTGCCCTACCGGAAGATTGCCTGTGACCCGGAGGCTGTGGAG
ATC
GTGGGCATCCCGGACAAGATCCCCTTCAAGCGCCCCTGCACTTATGGAGTCCCCAAGCTGAAGCGGA
TC
CTGGAGGAGCGCCATAGTATCCACTTCATCATTAAGAGGATGTTTGATGAGCGAATTTTCACAGGGAA
C
AAGTTTACCAAAGACACCACGAAGCTGGAGCCAGCCAGCCCGCCAGAGGACACCTCTGCAGAGGTCTCT
AGG
GCCACCGTCCTTGACCTTGCTGGGAATGCTCGGTCAGACAAGGGCAGCATGTCTGAAGACTGTGGGC
CA
GGAACCTCCGGGGAGCTGGGCGGGCTGAGGCCGATCAAAATTGAGCCAGAGGATCTGGACATCATTCA
G
GTCACCGTCCCAGACCCCTCGCCAACCTCTGAGGAAATGACAGACTCGATGCCTGGGCACCTGCCATCG
GAG
GATTCTGGTTATGGGATGGAGATGCTGACAGACAAAGGTCTGAGTGAGGACGCGCGGCCCGAGGAGA
GG
CCCGTGGAGGACAGCCACGGTGACGTGATCCGGCCCCTGCGGAAGCAGGTGGAGCTGCTCTTCAACAC
A
CGATACGCCAAGGCCATTGGCATCTCGGAGCCCGTCAAGGTGCCGTACTCCAAGTTTCTGATGCACCCG
GAG
GAGCTGTTTGTGGTGGGACTGCCTGAAGGCATCTCCCTCCGCAGGCCCAACTGCTTCGGGATCGCCA
AG
CTCCGGAAGATTCTGGAGGCCAGCAACAGCATCCAGTTTGTCATCAAGAGGCCCGAGCTGCTCACTGA
G
GGAGTCAAAGAGCCCATCATGGATAGTCAAGAGAGGGATTCCGGGGACCCTCTGGTGGACGAGAGCCTG
AAG
AGACAGGGCTTTCAAGAAAATTATGACGCGAGGCTCTCACGGATCGACATCGCCAACACACTAAGGG
AG
CAGGTCCAGGACCTTTTCAATAAGAAATACGGGGAAGCCTTGGGCATCAAGTACCCGGTCCAGGTCCC
C
TACAAGCGGATCAAGAGTAACCCCGGCTCCGTGATCATCGAGGGGCTGCCCCCAGGAATCCCGTTCCGA
AAG
CCCTGTACCTTCGGCTCCCAGAACCTGGAGAGGATTCTTGCTGTGGCTGACAAGATCAAGTTCACAG
TC
ACCAGGCCTTTCCAAGGACTCATCCCAAAGCCTGATGAAGATGACGCCAACAGACTCGGGGAGAAGGT
G
ATCCTGCGGGAGCAGGTGAAGGAACTCTTCAACGAGAAATACGGTGAGGCCCTGGGCCTGAACCGGCCG
GTG
CTGGTCCCTTATAAACTAATCCGGGACAGCCCAGACGCCGTGGAGGTCACGGGTCTGCCTGATGACA
TC
CCCTTCCGGAACCCCAACACGTACGACATCCACCGGCTGGAGAAGATCCTGAAGGCCCGAGAGCATGT
C
CGCATGGTCATCATTAACCAGCTCCAACCCTTTGCAGAAATCTGCAATGATGCCAAGGTGCCAGCCAAA
GAC
AGCAGCATTCCCAAGCGCAAGAGAAAGCGGGTCTCGGAAGGAAATTCCGTCTCCTCTTCCTCCTCGT
CT
TCCTCTTCCTCGTCCTCTAACCCGGATTCAGTGGCATCGGCCAACCAGATCTCACTCGTGCAATGGCC
A
ATGTACATGGTGGACTATGCCGGCCTGAACGTGCAGCTCCCGGGACCTCTTAATTACTAG


Translation (976 aa):
MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNAEVACVAVHDESAFVVGTEKG
R
MFLNARKELQSDFLRFC
LSAAQHRAATSQLEGRVVRRVLTVASRALCPTGGPPWKDPEAEHPKKVQRGE
G
GGRSLPRSSLEHGSDVYLLRKMVEEVFDVLY
SEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRP
A
EYDPKALMAILEHSHRIRFKLK
RPLEDGGRDSKALVELNGVSLIPKGSRDCGLHGQAPKVPPQDLPPTA
T
SSSMASFLYSTALPNHAIRELKQEAPSCPLAPSDLGLSRPMPEPKATGAQDFSDCC
GQKPTGPGGPLIQ
N
VHASKRILFSIVHDKS
EKWDAFIKETEDINTLRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVE
I
VGIPDKIPFKRPCTYGVPKLKRILEERHSIHFIIK
RMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVS
R
ATVLDLAGNA
RSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPS
E
DSGYGMEMLT
DKGLSEDARPEERPVEDSHGDVIRPLRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHP
E
ELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIK
RPELLTEGVKEPIMDSQERDSGDPLVDESL
K
RQGFQ
ENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFR
K
PCTFGSQNLERILAVADKIKFTVT
RPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRP
V
LVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQL
QPFAEICNDAKVPAK
D
SSIPKRKRKRVSEGNSVSSSSSSSSSSSSNPDSVASANQISLV
QWPMYMVDYAGLNVQLPGPLNY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser