NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS56071.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56071.1 Public Homo sapiens 18 MBD1 22 109 92 CCDS HistoryNCBI Gene:4152Re-query CCDS DB by CCDS ID:56071.1Re-query CCDS DB by GeneID:4152See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56071.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000591535.5 ENSP00000465923.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000591535.5Link to Ensembl Protein Viewer:ENSP00000465923.1Re-query CCDS DB by Nucleotide ID:ENST00000591535Re-query CCDS DB by Protein ID:ENSP00000465923
Original member NCBI NM_001204151.2 NP_001191080.1 Updated not alive Link to Nucleotide Sequence:NM_001204151.2Link to Protein Sequence:NP_001191080.1Re-query CCDS DB by Nucleotide ID:NM_001204151Re-query CCDS DB by Protein ID:NP_001191080
Current member NCBI NM_001204151.3 NP_001191080.1 Accepted alive Link to Nucleotide Sequence:NM_001204151.3Link to Protein Sequence:NP_001191080.1Re-query CCDS DB by Nucleotide ID:NM_001204151Re-query CCDS DB by Protein ID:NP_001191080Link to BLAST:NP_001191080.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001191080.1 536 Q9UIS9-8 536 100% 0 0

Chromosomal Locations for CCDS 56071.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 50271501 50271540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50272677 50272738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50272824 50272955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50273564 50273863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50274186 50274353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50275129 50275245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50275600 50275728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50275835 50275981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50276378 50276418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50276662 50276744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50276832 50276998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50277090 50277204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 50279883 50279992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1611 nt):
ATGGCTGAGGACTGGCTGGACTGCCCGGCCCTGGGCCCTGGCTGGAAGCGCCGCGAAGTCTTTCGCAAGT
CA
GGGGCCACCTGTGGACGCTCAGACACCTATTACCAGAGCCCCACAGGAGACAGGATCCGAAGCAAAGT
T
GAGCTGACTCGATACCTGGGCCCTGCGTGTGATCTCACCCTCTTCGACTTCAAACAAGGCATCTTGTGC
TAT
CCAGCCCCCAAGGCCCATCCCGTGGCGGTTGCCAGCAAGAAGCGAAAGAAGCCTTCAAGGCCAGCCA
AG
ACTCGGAAACGTCAGGTTGGACCCCAGAGTGGTGAGGTCAGGAAGGAGGCCCCGAGGGATGAGACCAA
G
GCTGACACTGACACAGCCCCAGCTTCATTCCCTGCTCCTGGGTGCTGTGAGAACTGTGGAATCAGCTTC
TCA
GGGGATGGCACCCAAAGGCAGCGGCTCAAAACGTTGTGCAAAGACTGTCGAGCACAGAGAATTGCCT
TC
AACCGGGAACAGAGAATGTTTAAGCGTGTGGGCTGTGGGGAGTGTGCAGCCTGCCAGGTAACAGAAGA
C
TGTGGGGCCTGCTCCACCTGCCTCCTGCAGCTGCCCCATGATGTGGCATCGGGGCTGTTCTGCAAGTGT
GAA
CGGAGACGCTGCCTCCGGATTGTGGAAAGGAGCCGAGGGTGTGGAGTATGCCGGGGCTGTCAGACCC
AA
GAGGATTGTGGCCATTGCCCCATCTGCCTTCGCCCTCCCCGCCCTGGTCTCAGGCGCCAGTGGAAATG
T
GTCCAGCGACGTTGCCTACGGGGTAAACATGCCCGCCGCAAGGGAGGCTGTGACTCCAAGATGGCTGCC
AGG
CGGCGCCCCGGAGCCCAGCCACTGCCTCCACCACCCCCATCACAGTCCCCAGAGCCCACAGAGCCGC
AG
CCCTACACGAACCGCCGGCAGAACCGCAAGTGCGGGGCCTGTGCAGCCTGCCTACGGCGGATGGACTG
T
GGCCGCTGCGACTTCTGCTGCGACAAGCCCAAATTCGGGGGCAGCAACCAGAAGCGCCAGAAGTGTCGT
TGG
CGCCAATGCCTGCAGTTTGCCATGAAGCGGCTGCTGCCCAGTGTCTGGTCAGAGTCTGAGGATGGGG
CA
GGATCGCCCCCACCTTACCGTCGTCGAAAGAGGCCCAGCTCTGCCCGACGGCACCATCTTGGCCCTAC
C
TTGAAGCCCACCTTGGCTACACGCACAGCCCAACCAGACCATACCCAGGCTCCAACGAAGCAGGAAGCA
GGT
GGTGGCTTTGTGCTGCCCCCGCCTGGCACTGACCTTGTGTTTTTACGGGAAGGCGCAAGCAGTCCTG
TG
CAGGTGCCGGGCCCTGTTGCAGCTTCCACAGAAGCCCTGTTGCAGGCAGTAGACCCAGGCCTGCCTTC
T
GTGAAGCAAGAGCCACCTGACCCAGAGGAGGACAAGGAGGAGAACAAGGATGATTCTGCCTCCAAATTG
GCC
CCAGAGGAAGAGGCAGGAGGGGCTGGCACACCCGTGATCACGGAGATTTTCAGCCTGGGTGGAACCC
GC
TTCCGAGATACAGCAGTCTGGTTGCCAAGGTCCAAAGACCTTAAAAAACCTGGAGCTAGAAAGCAGTA
G


Translation (536 aa):
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILC
Y
PAPK
AHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISF
S
GDGTQRQRLKTLCKDCR
AQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKC
E
RRRCLRIVER
SRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAA
R
RRPGAQPLPPPPPSQSPEPTEP
QPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCR
W
RQCLQFAM
KRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEA
G
GGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQ
AVDPGLPSVKQEPPDPEEDKEENKDDSASKL
A
PEEEAGGAGTPV
ITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser