NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55997.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55997.1 Public Homo sapiens 16 USB1 22 109 92 CCDS HistoryNCBI Gene:79650Re-query CCDS DB by CCDS ID:55997.1Re-query CCDS DB by GeneID:79650See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55997.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000423271.7 ENSP00000409792.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000423271.7Link to Ensembl Protein Viewer:ENSP00000409792.3Re-query CCDS DB by Nucleotide ID:ENST00000423271Re-query CCDS DB by Protein ID:ENSP00000409792
Original member Current member NCBI NM_001204911.1 NP_001191840.1 Accepted alive Link to Nucleotide Sequence:NM_001204911.1Link to Protein Sequence:NP_001191840.1Re-query CCDS DB by Nucleotide ID:NM_001204911Re-query CCDS DB by Protein ID:NP_001191840Link to BLAST:NP_001191840.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001191840.1 186 Q9BQ65-3 186 100% 0 0

Chromosomal Locations for CCDS 55997.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 58001484 58001581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 58002479 58002645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 58009929 58010112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 58011018 58011129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (561 nt):
ATGAGCGCGGCGCCCCTGGTGGGCTACAGCAGCAGCGGCTCCGAGGATGAGTCCGAGGACGGGATGCGGA
CC
AGGCCGGGGGATGGGAGCCACCGTCGTGGCCAGAGCCCCCTTCCCAGGCAGAGATTTCCAGTACCTGA
C
AGTGTGCTGAACATGTTCCCGGGCACCGAGGAGGGGCCTGAAGATGACAGCACAAAACACGGGGGACGG
GTG
CGCACCTTCCCCCACGAGCGAGGCAACTGGGCCACCCACGTCTATGTACCATATGAAGCCAAGGAGG
AG
TTCCTGGATCTGCTTGATGTGTTGCTGCCCCATGCCCAGACATATGTCCCCCGGCTGGTAAGGATGAA
G
GTGTTCCACCTCAGCCTGTCCCAGAGTGTGGTTCTGCGCCACCACTGGATCCTCCCCTTCGTGCAGGCT
CTG
AAAGCCCGTATGACCTCCTTCCACAGCCCCCATCCAGGACCTCATTGCCTCATTGGAACCAAAGATG
CC
CCTGTCACCCAGGAAATTCCAAAGGATTTAGGAGCTCTGCGTCAGGAGCCAGGATCACAGACCAGATA
A


Translation (186 aa):
MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGR
V
RTFPHERGNWATHVYVP
YEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQA
L
KARMTSFH
SPHPGPHCLIGTKDAPVTQEIPKDLGALRQEPGSQTR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser