NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55864.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55864.1 Public Homo sapiens 12 ANKS1B 20 108 85 CCDS HistoryNCBI Gene:56899Re-query CCDS DB by CCDS ID:55864.1Re-query CCDS DB by GeneID:56899See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55864.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000341752 ENSP00000345510 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341752Link to Ensembl Protein Viewer:ENSP00000345510Re-query CCDS DB by Nucleotide ID:ENST00000341752Re-query CCDS DB by Protein ID:ENSP00000345510
Original member Current member EBI,WTSI OTTHUMT00000408422 OTTHUMP00000272119 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000408422Link to Vega Protein Viewer:OTTHUMP00000272119Re-query CCDS DB by Nucleotide ID:OTTHUMT00000408422Re-query CCDS DB by Protein ID:OTTHUMP00000272119
Original member Current member NCBI NM_001204081.1 NP_001191010.1 Accepted alive Link to Nucleotide Sequence:NM_001204081.1Link to Protein Sequence:NP_001191010.1Re-query CCDS DB by Nucleotide ID:NM_001204081Re-query CCDS DB by Protein ID:NP_001191010Link to BLink:NP_001191010.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001191010.1 254 Q7Z6G8-9 254 100% 0 0

Chromosomal Locations for CCDS 55864.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 98735560 98735634 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98751355 98751522 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98773042 98773179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98781117 98781203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98782126 98782137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98798934 98799005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98800997 98801125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98829174 98829257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (765 nt):
ATGCAGGGCGATGCAAGGAGGAGAAGAAATGAAAACTACTTTGATGATATTCCCCGATCAAAACTGGAGA
GG
CAGATGGCTCAGACAGGAGACTGGGGAGAACCTTCCATTACCTTGCGACCTCCGAATGAAGCCACAGC
C
TCTACCCCGGTACAGTACTGGCAGCATCACCCAGAAAAGCTTATCTTCCAGTCGTGTGATTACAAAGCT
TTT
TATTTAGGTTCTATGCTGATAAAAGAGCTTAGGGGGACAGAATCAACCCAAGATGCTTGTGCAAAAA
TG
CGGGCTAACTGTCAGAAGTCTACAGAGCAAATGAAGAAGGTCCCTACTATTATTCTTTCTGTCTCATA
T
AAAGGAGTCAAATTTATTGATGCAACAAATAAGAACATAATTGCTGAGCATGAAATTCGTAATATCTCC
TGT
GCTGCCCAGGACCCAGAAGACCTCTCAACATTTGCCTATATCACAAAAGATTTGAAGTCTAATCACC
AC
TACTGTCATGTGTTTACTGCCTTTGATGTGAATTTAGCCTATGAAATCATCCTAACCCTGGGACAGGC
A
TTCGAAGTCGCTTACCAGCTAGCACTACAAGCAAGAAAAGGGGGACACTCCTCCACACTTCCAGAAAGC
TTT
GAAAACAAACCCTCCAAACCCATCCCCAAGCCCCGCGTTAGCATTCGCAAGTCCGTGGATCTTCTTC
AT
GCCAGCCATACCGGGCAGGAACCATCAGAGAGACACACTGAGGAGGCACTCAGAAAATTTTGA


Translation (254 aa):
MQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKA
F
YLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNIS
C
AAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDV
NLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPES
F
ENKPSKPIPKPRVSIRKSV
DLLHASHTGQEPSERHTEEALRKF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser