NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS53651.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53651.1 Public Homo sapiens 11 MARK2 22 109 92 CCDS HistoryNCBI Gene:2011Re-query CCDS DB by CCDS ID:53651.1Re-query CCDS DB by GeneID:2011See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53651.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000350490.11 ENSP00000294247.9 Accepted alive Link to Ensembl Transcript Viewer:ENST00000350490.11Link to Ensembl Protein Viewer:ENSP00000294247.9Re-query CCDS DB by Nucleotide ID:ENST00000350490Re-query CCDS DB by Protein ID:ENSP00000294247
Original member NCBI NM_001163297.1 NP_001156769.1 Updated not alive Link to Nucleotide Sequence:NM_001163297.1Link to Protein Sequence:NP_001156769.1Re-query CCDS DB by Nucleotide ID:NM_001163297Re-query CCDS DB by Protein ID:NP_001156769
Current member NCBI NM_001163297.2 NP_001156769.1 Accepted alive Link to Nucleotide Sequence:NM_001163297.2Link to Protein Sequence:NP_001156769.1Re-query CCDS DB by Nucleotide ID:NM_001163297Re-query CCDS DB by Protein ID:NP_001156769Link to BLAST:NP_001156769.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001156769.1 709 Q7KZI7-15 709 100% 0 0

Chromosomal Locations for CCDS 53651.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 63839507 63839560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63895159 63895338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63895580 63895633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63898232 63898280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63898608 63898673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63898763 63898833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63899052 63899108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63899874 63900110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63900559 63900678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63900780 63900879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63900957 63901069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63902198 63902330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63902604 63902782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63903061 63903158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63904786 63905043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63908877 63909237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2130 nt):
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGCCCACCTTGGGACACC
TT
GACTCCAAGCCCAGCAGTAAGTCCAACATGATTCGGGGCCGCAACTCAGCCACCTCTGCTGATGAGCA
G
CCCCACATTGGAAACTACCGGCTCCTCAAGACCATTGGCAAGGGTAATTTTGCCAAGGTGAAGTTGGCC
CGA
CACATCCTGACTGGGAAAGAGGTAGCTGTGAAGATCATTGACAAGACTCAACTGAACTCCTCCAGCC
TC
CAGAAACTATTCCGCGAAGTAAGAATAATGAAGGTTTTGAATCATCCCAACATAGTTAAATTATTTGA
A
GTGATTGAGACTGAGAAAACGCTCTACCTTGTCATGGAGTACGCTAGTGGCGGAGAGGTATTTGATTAC
CTA
GTGGCTCATGGCAGGATGAAAGAAAAAGAGGCTCGAGCCAAATTCCGCCAGATAGTGTCTGCTGTGC
AG
TACTGTCACCAGAAGTTTATTGTCCATAGAGACTTAAAGGCAGAAAACCTGCTCTTGGATGCTGATAT
G
AACATCAAGATTGCAGACTTTGGCTTCAGCAATGAATTCACCTTTGGGAACAAGCTGGACACCTTCTGT
GGC
AGTCCCCCTTATGCTGCCCCAGAACTCTTCCAGGGCAAAAAATATGATGGACCCGAGGTGGATGTGT
GG
AGCCTAGGAGTTATCCTCTATACACTGGTCAGCGGATCCCTGCCTTTTGATGGACAGAACCTCAAGGA
G
CTGCGGGAACGGGTACTGAGGGGAAAATACCGTATTCCATTCTACATGTCCACGGACTGTGAAAACCTG
CTT
AAGAAATTTCTCATTCTTAATCCCAGCAAGAGAGGCACTTTAGAGCAAATCATGAAAGATCGATGGA
TG
AATGTGGGTCACGAAGATGATGAACTAAAGCCTTACGTGGAGCCACTCCCTGACTACAAGGACCCCCG
G
CGGACAGAGCTGATGGTGTCCATGGGTTATACACGGGAAGAGATCCAGGACTCGCTGGTGGGCCAGAGA
TAC
AACGAGGTGATGGCCACCTATCTGCTCCTGGGCTACAAGAGCTCCGAGCTGGAAGGCGACACCATCA
CC
CTGAAACCCCGGCCTTCAGCTGATCTGACCAATAGCAGCGCCCCATCCCCATCCCACAAGGTACAGCG
C
AGCGTGTCGGCCAATCCCAAGCAGCGGCGCTTCAGCGACCAGGCTGGTCCTGCCATTCCCACCTCTAAT
TCT
TACTCTAAGAAGACTCAGAGTAACAACGCAGAAAATAAGCGGCCTGAGGAGGACCGGGAGTCAGGGC
GG
AAAGCCAGCAGCACAGCCAAGGTGCCTGCCAGCCCCCTGCCCGGTCTGGAGAGGAAGAAGACCACCCC
A
ACCCCCTCCACGAACAGCGTCCTCTCCACCAGCACAAATCGAAGCAGGAATTCCCCACTTTTGGAGCGG
GCC
AGCCTCGGCCAGGCCTCCATCCAGAATGGCAAAGACAGCACAGCCCCCCAGCGTGTCCCTGTTGCCT
CC
CCATCCGCCCACAACATCAGCAGCAGTGGTGGAGCCCCAGACCGAACTAACTTCCCCCGGGGTGTGTC
C
AGCCGAAGCACCTTCCATGCTGGGCAGCTCCGACAGGTGCGGGACCAGCAGAATTTGCCCTACGGTGTG
ACC
CCAGCCTCTCCCTCTGGCCACAGCCAGGGCCGGCGGGGGGCCTCTGGGAGCATCTTCAGCAAGTTCA
CC
TCCAAGTTTGTACGCAGACCTCACGTGGTGGGCAGTGGCGGCAACGACAAAGAAAAGGAAGAATTTCG
G
GAGGCCAAGCCCCGCTCCCTCCGCTTCACGTGGAGTATGAAGACCACGAGCTCCATGGAGCCCAACGAG
ATG
ATGCGGGAGATCCGCAAGGTGCTGGACGCGAACAGCTGCCAGAGCGAGCTGCATGAGAAGTACATGC
TG
CTGTGCATGCACGGCACGCCGGGCCACGAGGACTTCGTGCAGTGGGAGATGGAGGTGTGCAAACTGCC
G
CGGCTCTCTCTCAACGGGGTTCGATTTAAGCGGATATCGGGCACCTCCATGGCCTTCAAAAACATTGCC
TCC
AAAATAGCCAACGAGCTGAAGCTTTAA


Translation (709 aa):
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLA
R
HILTGKE
VAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDY
L
VAHGRMKEKEARAKFRQ
IVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFC
G
SPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLK
ELRERVLRGKYRIPFYMSTDCENL
L
KKFLILNPSKRGTLE
QIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQR
Y
NEVMATYLLLGYKSSE
LEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAGPAIPTSN
S
YSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPST
NSVLSTSTNRSRNSPLLER
A
SLGQASIQNGKD
STAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGV
T
PASPSGHSQGRRGASGSIFSKFTSKFVR
RPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
M
MREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIA
S
KIANELKL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser