NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS53318.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53318.1 Public Homo sapiens 1 SCP2 22 109 92 CCDS HistoryNCBI Gene:6342Re-query CCDS DB by CCDS ID:53318.1Re-query CCDS DB by GeneID:6342See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53318.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000407246.6 ENSP00000384569.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000407246.6Link to Ensembl Protein Viewer:ENSP00000384569.2Re-query CCDS DB by Nucleotide ID:ENST00000407246Re-query CCDS DB by Protein ID:ENSP00000384569
Original member NCBI NM_001193599.1 NP_001180528.1 Updated not alive Link to Nucleotide Sequence:NM_001193599.1Link to Protein Sequence:NP_001180528.1Re-query CCDS DB by Nucleotide ID:NM_001193599Re-query CCDS DB by Protein ID:NP_001180528
Current member NCBI NM_001193599.2 NP_001180528.1 Accepted alive Link to Nucleotide Sequence:NM_001193599.2Link to Protein Sequence:NP_001180528.1Re-query CCDS DB by Nucleotide ID:NM_001193599Re-query CCDS DB by Protein ID:NP_001180528Link to BLAST:NP_001180528.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001180528.1 523 P22307-8 523 100% 0 0

Chromosomal Locations for CCDS 53318.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 52927397 52927465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52941796 52941853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52950755 52950886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52954740 52954804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52961503 52961629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52974769 52974832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52976683 52976769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52978217 52978367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52980396 52980543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 52988029 52988136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53014890 53015043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53027969 53028071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53038917 53039046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53047858 53047937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53050609 53050704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1572 nt):
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGT
TT
GTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTG
T
GGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGT
GCT
ACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGG
CT
CTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGA
T
AAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGG
TAT
GCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAA
AT
CATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGC
A
TCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCA
ATT
TTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAG
AA
ATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAG
T
AAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTT
CAC
GATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTG
CA
ACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGAT
T
TCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGG
GAA
GCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTG
TG
GTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGC
T
GTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTT
GAA
GAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTG
GG
GGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGATAA
G
AAGGCTGACTGCACAATCACAATGGCTGACTCAGACTTCCTGGCTTTAATGACTGGTAAAATGAATCCT
CAG
TCGGCCTTCTTTCAAGGCAAATTGAAAATCACTGGCAACATGGGTCTCGCTATGAAGTTACAAAATC
TT
CAGCTTCAGCCAGGCAACGCTAAGCTCTGA


Translation (523 aa):
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGDSTCGQRAIYHSLGMTGIPIINVNNNC
A
TGSTALFMARQLIQG
GVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFG
Y
AGKEHMEKY
GTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAA
I
LASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKM
VGFDMSKEAARKCYEKSGLTPNDIDVIEL
H
DCFSTNELLTYEALGLCPE
GQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRG
E
AGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAA
SSFRTHQIEAVPTSSASDGFKANLVFKEIEKKL
E
E
EGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNP
Q
S
AFFQGKLKITGNMGLAMKLQNLQLQPGNAKL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser