NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4921.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4921.1 Public Homo sapiens 6 TNFRSF21 22 109 92 CCDS HistoryNCBI Gene:27242Re-query CCDS DB by CCDS ID:4921.1Re-query CCDS DB by GeneID:27242See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4921.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000296861.2 ENSP00000296861.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000296861.2Link to Ensembl Protein Viewer:ENSP00000296861.2Re-query CCDS DB by Nucleotide ID:ENST00000296861Re-query CCDS DB by Protein ID:ENSP00000296861
Original member Current member NCBI NM_014452.4 NP_055267.1 Accepted alive Link to Nucleotide Sequence:NM_014452.4Link to Protein Sequence:NP_055267.1Re-query CCDS DB by Nucleotide ID:NM_014452Re-query CCDS DB by Protein ID:NP_055267Link to BLAST:NP_055267.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055267.1 655 O75509 655 100% 0 0

Chromosomal Locations for CCDS 4921.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 47232765 47232994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 47234670 47234898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 47253256 47253521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 47283938 47284432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 47285944 47286595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 47309416 47309511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1968 nt):
ATGGGGACCTCTCCGAGCAGCAGCACCGCCCTCGCCTCCTGCAGCCGCATCGCCCGCCGAGCCACAGCCA
CG
ATGATCGCGGGCTCCCTTCTCCTGCTTGGATTCCTTAGCACCACCACAGCTCAGCCAGAACAGAAGGC
C
TCGAATCTCATTGGCACATACCGCCATGTTGACCGTGCCACCGGCCAGGTGCTAACCTGTGACAAGTGT
CCA
GCAGGAACCTATGTCTCTGAGCATTGTACCAACACAAGCCTGCGCGTCTGCAGCAGTTGCCCTGTGG
GG
ACCTTTACCAGGCATGAGAATGGCATAGAGAAATGCCATGACTGTAGTCAGCCATGCCCATGGCCAAT
G
ATTGAGAAATTACCTTGTGCTGCCTTGACTGACCGAGAATGCACTTGCCCACCTGGCATGTTCCAGTCT
AAC
GCTACCTGTGCCCCCCATACGGTGTGTCCTGTGGGTTGGGGTGTGCGGAAGAAAGGGACAGAGACTG
AG
GATGTGCGGTGTAAGCAGTGTGCTCGGGGTACCTTCTCAGATGTGCCTTCTAGTGTGATGAAATGCAA
A
GCATACACAGACTGTCTGAGTCAGAACCTGGTGGTGATCAAGCCGGGGACCAAGGAGACAGACAACGTC
TGT
GGCACACTCCCGTCCTTCTCCAGCTCCACCTCACCTTCCCCTGGCACAGCCATCTTTCCACGCCCTG
AG
CACATGGAAACCCATGAAGTCCCTTCCTCCACTTATGTTCCCAAAGGCATGAACTCAACAGAATCCAA
C
TCTTCTGCCTCTGTTAGACCAAAGGTACTGAGTAGCATCCAGGAAGGGACAGTCCCTGACAACACAAGC
TCA
GCAAGGGGGAAGGAAGACGTGAACAAGACCCTCCCAAACCTTCAGGTAGTCAACCACCAGCAAGGCC
CC
CACCACAGACACATCCTGAAGCTGCTGCCGTCCATGGAGGCCACTGGGGGCGAGAAGTCCAGCACGCC
C
ATCAAGGGCCCCAAGAGGGGACATCCTAGACAGAACCTACACAAGCATTTTGACATCAATGAGCATTTG
CCC
TGGATGATTGTGCTTTTCCTGCTGCTGGTGCTTGTGGTGATTGTGGTGTGCAGTATCCGGAAAAGCT
CG
AGGACTCTGAAAAAGGGGCCCCGGCAGGATCCCAGTGCCATTGTGGAAAAGGCAGGGCTGAAGAAATC
C
ATGACTCCAACCCAGAACCGGGAGAAATGGATCTACTACTGCAATGGCCATGGTATCGATATCCTGAAG
CTT
GTAGCAGCCCAAGTGGGAAGCCAGTGGAAAGATATCTATCAGTTTCTTTGCAATGCCAGTGAGAGGG
AG
GTTGCTGCTTTCTCCAATGGGTACACAGCCGACCACGAGCGGGCCTACGCAGCTCTGCAGCACTGGAC
C
ATCCGGGGCCCCGAGGCCAGCCTCGCCCAGCTAATTAGCGCCCTGCGCCAGCACCGGAGAAACGATGTT
GTG
GAGAAGATTCGTGGGCTGATGGAAGACACCACCCAGCTGGAAACTGACAAACTAGCTCTCCCGATGA
GC
CCCAGCCCGCTTAGCCCGAGCCCCATCCCCAGCCCCAACGCGAAACTTGAGAATTCCGCTCTCCTGAC
G
GTGGAGCCTTCCCCACAGGACAAGAACAAGGGCTTCTTCGTGGATGAGTCGGAGCCCCTTCTCCGCTGT
GAC
TCTACATCCAGCGGCTCCTCCGCGCTGAGCAGGAACGGTTCCTTTATTACCAAAGAAAAGAAGGACA
CA
GTGTTGCGGCAGGTACGCCTGGACCCCTGTGACTTGCAGCCTATCTTTGATGACATGCTCCACTTTCT
A
AATCCTGAGGAGCTGCGGGTGATTGAAGAGATTCCCCAGGCTGAGGACAAACTAGACCGGCTATTCGAA
ATT
ATTGGAGTCAAGAGCCAGGAAGCCAGCCAGACCCTCCTGGACTCTGTTTATAGCCATCTTCCTGACC
TG
CTGTAG


Translation (655 aa):
MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKC
P
AGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQS
N
ATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNV
C
GTLPSFSSSTSPSPGTAIFPRPEHMETHEVPSSTYVPK
GMNSTESNSSASVRPKVLSSIQEGTVPDNTS
S
ARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL
P
WMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGH
GIDILK
L
VAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDV
V
EKIRGLMEDTTQ
LETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRC
D
STSSGSSALSRNGSFITK
EKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFE
I
IGVKSQEASQTLLDSVYSHLPDLL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser