NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46971.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46971.1 Public Homo sapiens 3 VPS8 22 109 92 CCDS HistoryNCBI Gene:23355Re-query CCDS DB by CCDS ID:46971.1Re-query CCDS DB by GeneID:23355See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46971.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000625842.2 ENSP00000487164.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000625842.2Link to Ensembl Protein Viewer:ENSP00000487164.1Re-query CCDS DB by Nucleotide ID:ENST00000625842Re-query CCDS DB by Protein ID:ENSP00000487164
Original member Current member NCBI NM_001009921.2 NP_001009921.1 Accepted alive Link to Nucleotide Sequence:NM_001009921.2Link to Protein Sequence:NP_001009921.1Re-query CCDS DB by Nucleotide ID:NM_001009921Re-query CCDS DB by Protein ID:NP_001009921Link to BLAST:NP_001009921.1
Original member Current member NCBI NM_001349292.1 NP_001336221.1 Accepted alive Link to Nucleotide Sequence:NM_001349292.1Link to Protein Sequence:NP_001336221.1Re-query CCDS DB by Nucleotide ID:NM_001349292Re-query CCDS DB by Protein ID:NP_001336221Link to BLAST:NP_001336221.1
Original member Current member NCBI NM_001349293.1 NP_001336222.1 Accepted alive Link to Nucleotide Sequence:NM_001349293.1Link to Protein Sequence:NP_001336222.1Re-query CCDS DB by Nucleotide ID:NM_001349293Re-query CCDS DB by Protein ID:NP_001336222Link to BLAST:NP_001336222.1
Original member Current member NCBI NM_001349294.1 NP_001336223.1 Accepted alive Link to Nucleotide Sequence:NM_001349294.1Link to Protein Sequence:NP_001336223.1Re-query CCDS DB by Nucleotide ID:NM_001349294Re-query CCDS DB by Protein ID:NP_001336223Link to BLAST:NP_001336223.1
Original member Current member NCBI NM_001349295.1 NP_001336224.1 Accepted alive Link to Nucleotide Sequence:NM_001349295.1Link to Protein Sequence:NP_001336224.1Re-query CCDS DB by Nucleotide ID:NM_001349295Re-query CCDS DB by Protein ID:NP_001336224Link to BLAST:NP_001336224.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001009921.1 1428 Q8N3P4-1 1428 100% 0 0
NP_001336221.1 1428 Q8N3P4-1 1428 100% 0 0
NP_001336222.1 1428 Q8N3P4-1 1428 100% 0 0
NP_001336223.1 1428 Q8N3P4-1 1428 100% 0 0
NP_001336224.1 1428 Q8N3P4-1 1428 100% 0 0

Chromosomal Locations for CCDS 46971.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 184824633 184824785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184826163 184826231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184832689 184832819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184834649 184834742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184838714 184838746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184839698 184839752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184843240 184843245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184849071 184849195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184849936 184850022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184852500 184852567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184853857 184854010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184854114 184854173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184855711 184855818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184859985 184860065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184862897 184863067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184866876 184866950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184868024 184868059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184868946 184869036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184869482 184869528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184870716 184870805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184886110 184886156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184894703 184894925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184898565 184898654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184900921 184900972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184913519 184913561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184914981 184915053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184915355 184915474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184920127 184920198 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184924862 184924981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184926594 184926650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184928451 184928533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184929580 184929664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184930470 184930568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184936246 184936335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184940197 184940243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184957374 184957521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184964468 184964557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184966671 184966713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184971649 184971752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184982566 184982647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184983012 184983094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184993983 184994063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184996332 184996501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184999696 184999861 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 185024336 185024389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 185048479 185048559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 185051876 185052025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4287 nt):
ATGGAAAATGAACCAGACCATGAAAATGTGGAACAGAGCCTCTGTGCCAAGACGAGCGAAGAAGAGCTGA
AT
AAGTCTTTCAATCTAGAAGCTTCACTTTCAAAATTCTCTTACATAGATATGGACAAGGAACTGGAGTT
C
AAAAATGATCTGATTGATGACAAGGAGTTTGATATTCCTCAAGTTGATACTCCTCCAACACTGGAAAGC
ATA
CTAAATGAGACTGATGATGAAGATGAGTCTTTTATTCTTGAGGATCCTACATTGTTAAACATTGATA
CT
ATTGATTCTCACTCCTATGATACTTCATCTGTGGCAAGCTCAGATAGTGGTGACAGGACCAACTTAAA
A
AGGAAGAAGAAATTACCTGATTCTTTTTCACTTCATGGATCAGTTATGCGCCATTCACTTTTGAAGGGA
ATT
TCTGCCCAGATAGTGTCTGCAGCTGACAAAGTAGATGCTGGCTTGCCTACAGCAATTGCAGTATCCA
GT
CTGATAGCAGTGGGTACATCTCATGGATTGGCTTTAATATTTGGAAAAGATCAGAATCAAGCTTTGCG
A
CTCTGTCTGGGTAGCACTAGTGTTGGAGGTCAGTATGGCGCTATCTCTGCCCTCAGTATCAACAATGAT
TGC
TCAAGACTTCTTTGTGGCTTTGCTAAAGGACAGATCACCATGTGGGATTTGGCCAGTGGAAAACTTC
TA
AGATCAATAACAGATGCTCATCCTCCAGGAACAGCAATATTGCATATCAAGTTTACAGATGATCCAAC
T
CTTGCAATTTGCAACGACAGCGGAGGCTCTGTTTTTGAATTGACATTTAAGAGAGTGATGGGAGTGAGA
ACC
TGTGAATCTAGATGTCTGTTCAGTGGTTCCAAGGGTGAAGTCTGCTGTATTGAGCCTCTGCATTCTA
AG
CCTGAGTTGAAAGATCATCCCATCACACAGTTTTCATTATTGGCCATGGCATCCTTGACAAAAATACT
G
GTCATTGGATTGAAACCATCCTTGAAAGTATGGATGACTTTTCCCTATGGCCGGATGGATCCTTCCAGT
GTG
CCACTGCTGGCCTGGCACTTTGTAGCAGTACAAAATTACGTGAATCCCATGCTTGCCTTCTGCAGAG
GA
GATGTTGTTCATTTTCTATTGGTAAAGAGAGATGAATCTGGAGCAATACATGTTACTAAGCAAAAGCA
T
CTTCACCTATACTATGACCTCATCAACTTTACCTGGATAAATTCACGCACAGTTGTGCTCTTAGACAGC
GTA
GAGAAGTTGCATGTGATTGATCGGCAAACACAAGAGGAATTGGAGACAGTGGAGATCTCAGAAGTTC
AG
CTGGTCTACAATAGCAGCCATTTCAAATCACTAGCCACTGGAGGAAATGTTAGCCAGGCACTGGCTTT
G
GTTGGAGAGAAGGCTTGTTATCAATCCATCAGTAGCTATGGTGGTCAGATCTTTTATTTGGGGACAAAA
TCT
GTTTATGTGATGATGCTGAGGAGCTGGAGAGAGAGAGTGGATCATCTCCTGAAACAAGATTGTCTTA
CA
GAAGCGTTGGCTCTTGCGTGGTCTTTCCATGAAGGAAAAGCAAAAGCAGTAGTGGGATTATCAGGGGA
T
GCCAGTAAGCGAAAGGCTATTGTTGCAGACCGGATGGTAGAAATCCTATTCCATTATGCAGATCGAGCT
CTG
AAAAAGTGCCCAGACCAAGGAAAAATCCAAGTGATGGAGCAGCATTTTCAGGATATGGTGCCTGTCA
TA
GTTGATTACTGCCTTCTGCTGCAGCGAAAGGATCTTTTATTTAGTCAGATGTATGATAAATTAAGTGA
G
AATTCAGTGGCCAAAGGAGTATTTTTGGAGTGCCTTGAGCCATATATTTTAAGTGATAAATTGGTGGGA
ATC
ACACCCCAAGTAATGAAAGACTTGATTGTTCATTTCCAAGATAAAAAATTAATGGAAAATGTGGAAG
CG
CTCATTGTACATATGGATATCACCAGCCTAGATATTCAGCAGGTAGTTCTCATGTGTTGGGAAAATCG
T
TTATATGATGCTATGATCTATGTCTACAACAGAGGCATGAATGAATTTATTAGTCCAATGGAGAAACTT
TTC
AGAGTCATTGCTCCTCCTCTGAATGCAGGAAAAACACTAACAGATGAACAAGTTGTTATGGGCAATA
AG
CTCCTTGTATATATTAGCTGTTGTCTAGCAGGTCGTGCCTATCCCCTTGGTGACATCCCTGAAGATCT
G
GTTCCCTTGGTTAAAAACCAGGTTTTTGAATTTCTAATTCGCCTGCATTCAGCAGAGGCTTCTCCTGAG
GAA
GAAATCTATCCTTACATTCGGACTTTGCTACATTTTGACACAAGAGAATTTCTAAATGTATTGGCAC
TG
ACTTTTGAAGATTTTAAAAATGACAAGCAAGCTGTGGAATATCAACAGCGAATTGTGGATATTTTGTT
G
AAAGTTATGGTGGAGAATTCAGACTTTACCCCCTCACAAGTAGGATGTCTCTTTACCTTCCTTGCTCGG
CAG
CTTGCAAAGCCTGACAACACCTTGTTTGTAAACAGAACACTTTTTGATCAGGTCCTTGAATTCCTTT
GT
AGTCCTGACGATGACTCCCGACACTCTGAAAGACAGCAGGTCCTTTTAGAATTGCTGCAGGCTGGAGG
C
ATAGTTCAATTTGAAGAGAGTCGACTCATCCGGATGGCAGAAAAAGCTGAGTTCTATCAAATTTGTGAA
TTT
ATGTATGAAAGAGAACACCAATATGATAAAATTATTGATTGCTACTTACGTGACCCTCTGCGAGAGG
AA
GAAGTCTTTAATTACATTCACAATATCTTATCCATTCCCGGACACAGTGCAGAGGAGAAGCAGTCTGT
A
TGGCAGAAAGCAATGGATCATATTGAGGAACTCGTGTCCCTGAAGCCTTGTAAAGCTGCGGAGCTGGTT
GCC
ACCCACTTTTCTGGACATATTGAAACGGTCATTAAAAAACTTCAGAACCAGGTTTTGCTTTTCAAAT
TT
TTGAGGAGTCTTCTTGACCCAAGGGAAGGTATTCATGTAAATCAAGAATTACTGCAAATATCTCCTTG
T
ATCACAGAGCAGTTCATTGAGCTGTTGTGTCAGTTCAACCCAACCCAAGTTATAGAGACTCTGCAAGTC
CTT
GAGTGCTACCGTCTGGAAGAAACTATTCAGATTACTCAGAAGTATCAACTTCATGAAGTCACCGCTT
AT
CTATTGGAAAAGAAAGGAGATATTCATGGTGCCTTCCTAATAATGTTAGAGAGACTACAAAGCAAACT
T
CAAGAGGTAACACATCAAGGTGAAAATACCAAAGAGGATCCCTCATTGAAGGATGTTGAAGATACTATG
GTG
GAGACCATTGCTCTTTGCCAGAGAAATTCACATAATTTGAACCAGCAGCAACGTGAGGCACTTTGGT
TT
CCGTTATTGGAGGCAATGATGGCCCCTCAGAAGCTGTCCAGTTCAGCCATTCCTCATCTACACTCTGA
A
GCTCTGAAGTCTTTGACCATGCAAGTTTTAAATAGCATGGCAGCATTTATTGCCCTTCCATCAATCTTG
CAA
AGAATCTTACAGGATCCAGTTTATGGAAAAGGAAAACTTGGAGAAATCCAGGGACTTATCTTGGGAA
TG
TTAGATACCTTTAACTATGAACAAACCCTGCTGGAAACAACAACCAGCCTTCTAAACCAAGATCTCCA
T
TGGTCATTGTGTAACCTGAGAGCTTCGGTCACCAGAGGACTGAATCCCAAACAAGATTACTGCTCTATA
TGT
TTGCAGCAGTACAAGAGACGCCAAGAAATGGCTGATGAAATAATTGTCTTTAGCTGTGGCCATTTGT
AT
CACTCATTCTGCCTACAAAACAAAGAATGCACTGTGGAATTTGAGGGCCAAACAAGATGGACATGCTA
C
AAATGCAGTTCAAGTAACAAAGTAGGAAAACTCAGTGAAAATTCATCTGAAATTAAAAAGGGAAGGATA
ACC
CCATCACAGGTAAAAATGTCTCCATCGTATCATCAGTCCAAAGGGGATCCCACTGCTAAAAAGGGAA
CC
TCAGAACCTGTTCTGGATCCACAGCAAATCCAAGCATTTGATCAGCTTTGCCGTCTCTACCGAGGAAG
C
TCCAGGCTGGCTCTCCTCACGGAACTCTCCCAGAATCGCAGCAGCGAGAGCTATAGGCCATTCAGTGGC
TCG
CAGAGTGCTCCTGCTTTCAACAGCATCTTCCAGAATGAGAACTTCCAGCTGCAGCTCATTCCTCCAC
CT
GTGACTGAGGATTGA


Translation (1428 aa):
MENEPDHENVEQSLCAKTSEEELNKSFNLEASLSKFSYIDMDKELEFKNDLIDDKEFDIPQVDTPPTLES
I
LNE
TDDEDESFILEDPTLLNIDTIDSHSYDTSSVASSDSGDRTNLKRKKKLPDSFSLHGSVMRHSLLKG
I
SAQIVSAA
DKVDAGLPTAIAVSSLIAVGTSHGLALIFGKDQNQALRLCLGSTSVGGQYGAISALSINND
C
SRLLCGFAKGQ
ITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSGGSVFELTFKRVMGVR
T
CESRCLFSGSKGEVCCIEPLHSKPELKDHPITQFSLLAMASLTK
ILVIGLKPSLKVWMTFPYGRMDPSS
V
PLLAWHFVAVQNYVNPMLAFCRGDVVHFLL
VKRDESGAIHVTKQKHLHLYYDLINFTWINSRTVVLLDS
V
EKLHVIDRQTQEELETVEISEVQLVYNSSHFKSLATGGNVSQAL
ALVGEKACYQSISSYGGQIFYLGTK
S
VYVMMLRSWRE
RVDHLLKQDCLTEALALAWSFHEGKAKAVVGLSGDASKRKAIVADRMVEILFHYADRA
L
KKCPDQGKIQVMEQHFQ
DMVPVIVDYCLLLQRKDLLFSQMYDKLSENSVAKGVFLECLEPYILSDKLVG
I
TPQVMKDLIVHFQDKKLMENVEALIVHMDITSLDIQQ
VVLMCWENRLYDAMIYVYNRGMNEFISPMEKL
F
RVIAPPLNAGKTLT
DEQVVMGNKLLVYISCCLAGRAYPLGDIPEDLVPLVKNQVFEFLIRLHSAEASPE
E
EIYPYIRTLLHFDTREFLNVLAL
TFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLAR
Q
LAKPDNTLFVNRTLFDQ
VLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICE
F
MYEREHQYDKIIDCYLRDPLRE
EEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIEELVSLKPCKAAELV
A
THFSGHIETVIKKLQ
NQVLLFKFLRSLLDPREGIHVNQELLQISPCITEQFIELLCQFNPTQVIETLQV
L
ECYRLEETIQ
ITQKYQLHEVTAYLLEKKGDIHGAFLIMLERLQSKLQEVTHQGENTKEDPSLKDVEDTM
V
ETIALCQRNSHNLNQQQRE
ALWFPLLEAMMAPQKLSSSAIPHLHSEALKSLTMQVLNSMAAFIALPSIL
Q
RILQ
DPVYGKGKLGEIQGLILGMLDTFNYEQTLLETTTSLLNQDLHWSLCNLRASVTRGLNPKQDYCSI
C
LQQYKRRQEMADEIIVF
SCGHLYHSFCLQNKECTVEFEGQTRWTCYKCSSSNKVGKLSENSSEIKKGRI
T
PSQ
VKMSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSG
S
QSAPAFNSIFQNENFQLQLIPPPVTED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser