NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS46677.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46677.1 Public Homo sapiens 22 HPS4 20 108 85 CCDS HistoryNCBI Gene:89781Re-query CCDS DB by CCDS ID:46677.1Re-query CCDS DB by GeneID:89781See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46677.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000402105 ENSP00000384185 Accepted alive Link to Ensembl Transcript Viewer:ENST00000402105Link to Ensembl Protein Viewer:ENSP00000384185Re-query CCDS DB by Nucleotide ID:ENST00000402105Re-query CCDS DB by Protein ID:ENSP00000384185
Original member Current member EBI,WTSI OTTHUMT00000320781 OTTHUMP00000199897 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000320781Link to Vega Protein Viewer:OTTHUMP00000199897Re-query CCDS DB by Nucleotide ID:OTTHUMT00000320781Re-query CCDS DB by Protein ID:OTTHUMP00000199897
Original member Current member NCBI NM_152841.2 NP_690054.1 Accepted alive Link to Nucleotide Sequence:NM_152841.2Link to Protein Sequence:NP_690054.1Re-query CCDS DB by Nucleotide ID:NM_152841Re-query CCDS DB by Protein ID:NP_690054Link to BLAST:NP_690054.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_690054.1 703 Q9NQG7-3 703 100% 0 0

Chromosomal Locations for CCDS 46677.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 26453233 26453404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26457859 26457967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26458445 26458577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26463917 26464826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26465455 26465551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26466226 26466262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26468551 26468623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26470719 26470813 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26472302 26472418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26472832 26472939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26476993 26477136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 26479265 26479381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2112 nt):
ATGGCTCCACTCTGTTCTCTTGCCAGGTGGAATTATTTTTTTCTTTATGATGGTTCCAAGGTAAAGGAAG
AA
GGCGATCCAACAAGAGCTGGCATTTGTTACTTTTATCCTTCCCAGACCCTGCTAGACCAACAGGAGTT
G
CTTTGTGGACAGATTGCTGGAGTTGTCCGCTGTGTTTCTGACATTTCTGACTCTCCTCCTACTCTTGTT
CGT
CTGAGAAAACTGAAGTTTGCCATAAAAGTTGATGGAGATTACCTTTGGGTGCTGGGCTGTGCTGTGG
AG
CTCCCTGATGTCAGCTGCAAGCGGTTTCTGGATCAGCTAGTTGGATTCTTTAATTTTTACAATGGACC
T
GTTTCCCTAGCTTATGAGAACTGTTCTCAGGAAGAACTGAGCACGGAGTGGGACACCTTCATCGAGCAA
ATT
CTGAAAAACACCAGTGATCTGCATAAGATTTTCAATTCCCTCTGGAACTTGGACCAAACTAAAGTGG
AG
CCCCTGTTGTTGCTGAAGGCAGCCCGCATTCTGCAGACCTGCCAGCGCTCGCCTCACATTCTCGCTGG
C
TGCATCCTCTATAAAGGACTGATTGTCAGCACCCAACTCCCGCCCTCCCTCACCGCCAAGGTCCTGCTT
CAC
CGAACAGCACCTCAGGAGCAGAGACTCCCTACGGGAGAGGATGCCCCGCAGGAACATGGAGCGGCAT
TG
CCCCCGAATGTCCAGATTATCCCTGTTTTTGTGACCAAAGAGGAAGCCATTAGTCTCCACGAGTTCCC
G
GTGGAACAGATGACAAGGTCTCTAGCATCTCCAGCAGGACTCCAGGATGGTTCAGCCCAGCACCATCCA
AAG
GGTGGGAGCACATCTGCCCTGAAAGAAAACGCCACTGGCCATGTGGAATCCATGGCCTGGACCACCC
CA
GATCCCACATCCCCTGACGAAGCTTGTCCAGATGGCAGGAAGGAGAACGGATGCTTGTCTGGCCATGA
T
CTGGAGAGCATCAGGCCCGCAGGACTGCACAACTCTGCCAGGGGTGAGGTTCTTGGCCTCAGCTCCTCC
CTG
GGGAAGGAACTAGTCTTTCTCCAAGAAGAACTCGACTTGTCTGAAATCCACATTCCAGAGGCTCAGG
AA
GTGGAAATGGCCTCAGGTCATTTTGCCTTCCTACATGTGCCTGTTCCAGATGGCAGGGCTCCTTACTG
C
AAGGCATCTCTCAGCGCCTCCAGCAGCCTGGAACCCACGCCTCCTGAGGACACAGCCATCAGCAGCTTG
CGC
CCTCCCTCTGCTCCTGAGATGCTGACCCAGCATGGAGCCCAAGAGCAGCTCGAAGACCATCCTGGCC
AT
AGCAGCCAAGCCCCCATTCCCAGAGCAGACCCTCTCCCCAGAAGGACCCGCAGGCCCTTGTTATTGCC
T
CGCTTAGATCCAGGACAGAGAGGAAACAAGCTTCCCACGGGGGAACAAGGCCTGGATGAGGATGTTGAT
GGG
GTCTGTGAAAGCCACGCAGCCCCTGGTCTGGAATGCAGTTCAGGCTCAGCAAACTGTCAGGGTGCTG
GC
CCCTCTGCAGATGGAATCAGCTCCAGGCTGACACCAGCAGAGTCCTGCATGGGGCTCGTGAGGATGAA
T
CTCTACACTCACTGCGTCAAAGGGCTGGTGCTGTCCCTGCTGGCTGAGGAGCCGCTGCTGGGAGACAGC
GCA
GCCATAGAGGAAGTGTACCACAGCAGCCTGGCTTCACTGAATGGGCTGGAAGTCCACCTGAAAGAGA
CG
CTGCCCAGGGATGAGGCAGCCTCCACGAGCAGCACCTACAACTTCACACATTACGACCGCATTCAGAG
C
TTGCTGATGGCAAACCTGCCGCAGGTGGCCACCCCGCAGGATCGCCGCTTCCTCCAGGCCGTCAGCCTG
ATG
CATAGCGAATTTGCCCAGCTGCCCGCGCTTTATGAAATGACTGTCAGAAATGCCTCCACGGCTGTGT
AC
GCCTGTTGCAACCCCATCCAGGAGACATATTTCCAGCAGCTGGCACCTGCAGCACGGAGCTCCGGCTT
C
CCAAACCCTCAGGATGGCGCCTTCAGCCTCTCCGGCAAAGCAAAGCAGAAGCTGCTGAAGCACGGGGTG
AAC
TTGCTCTGA


Translation (703 aa):
MAPLCSLARWNYFFLYDGSKVKEEGDPTRAGICYFYPSQTLLDQQELLCGQIAGVVRCVSDISDSPPTLV
R
LRKLKFAIKVDGDYLW
VLGCAVELPDVSCKRFLDQLVGFFNFYNGPVSLAYENCSQEELSTEWDTFIEQ
I
LKNTSDLHKIFNSLWNLDQTK
VEPLLLLKAARILQTCQRSPHILAGCILYKGLIVSTQLPPSLTAKVLL
H
RTAPQEQ
RLPTGEDAPQEHGAALPPNVQIIPVFVTKEEAISLHEFPVEQMTRSLASPAGLQDGSAQHHP
K
GGSTSALKENATGHVESMAWTTPDPTSPDEACPDGRKENGCLSGHDLESIRPAGLHNSARGEVLGLSSS
L
GKELVFLQEELDLSEIHIPEAQEVEMASGHFAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDTAISSL
R
PPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPLPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDEDVD
G
VCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDS
A
AIEEV
YHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDRIQSLLMANLPQVATPQDRRFLQAVSL
M
HSEFAQLPALYEMTV
RNASTAVYACCNPIQETYFQQLAPAARSSGFPNPQDGAFSLSGKAKQKLLKHGV
N
LL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser