NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4604.1 Public Homo sapiens 6 HIST1H4H 22 109 92 CCDS HistoryNCBI Gene:8365Re-query CCDS DB by CCDS ID:4604.1Re-query CCDS DB by GeneID:8365See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4604.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000377727.1 ENSP00000366956.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377727.1Link to Ensembl Protein Viewer:ENSP00000366956.1Re-query CCDS DB by Nucleotide ID:ENST00000377727Re-query CCDS DB by Protein ID:ENSP00000366956
Original member Current member EBI,WTSI ENST00000635491.1 ENSP00000489236.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000635491.1Link to Ensembl Protein Viewer:ENSP00000489236.1Re-query CCDS DB by Nucleotide ID:ENST00000635491Re-query CCDS DB by Protein ID:ENSP00000489236
Original member Current member EBI,WTSI ENST00000634560.1 ENSP00000489319.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000634560.1Link to Ensembl Protein Viewer:ENSP00000489319.1Re-query CCDS DB by Nucleotide ID:ENST00000634560Re-query CCDS DB by Protein ID:ENSP00000489319
Original member Current member EBI,WTSI ENST00000634956.1 ENSP00000489567.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000634956.1Link to Ensembl Protein Viewer:ENSP00000489567.1Re-query CCDS DB by Nucleotide ID:ENST00000634956Re-query CCDS DB by Protein ID:ENSP00000489567
Original member Current member NCBI NM_003543.3 NP_003534.1 Accepted alive Link to Nucleotide Sequence:NM_003543.3Link to Protein Sequence:NP_003534.1Re-query CCDS DB by Nucleotide ID:NM_003543Re-query CCDS DB by Protein ID:NP_003534Link to BLAST:NP_003534.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003534.1 103 P62805 103 100% 0 0

Chromosomal Locations for CCDS 4604.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 26285188 26285499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (312 nt):
ATGTCTGGCCGTGGTAAAGGTGGAAAAGGTTTGGGTAAGGGAGGAGCTAAGCGTCATCGCAAGGTTTTGC
GC
GATAACATCCAGGGCATCACTAAGCCAGCTATCCGGCGCCTTGCTCGTCGCGGCGGTGTCAAGCGAAT
T
TCTGGCCTTATCTATGAGGAGACTCGTGGTGTTCTGAAGGTGTTCCTGGAGAACGTGATTCGTGACGCT
GTC
ACTTACACAGAGCACGCCAAACGCAAGACCGTGACAGCAATGGATGTGGTCTACGCGCTGAAGCGAC
AG
GGACGCACTCTTTACGGCTTCGGTGGCTAA


Translation (103 aa):
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
V
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser