NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS45914.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45914.1 Public Homo sapiens 19 NFIC 22 109 92 CCDS HistoryNCBI Gene:4782Re-query CCDS DB by CCDS ID:45914.1Re-query CCDS DB by GeneID:4782See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45914.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000589123.5 ENSP00000465655.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000589123.5Link to Ensembl Protein Viewer:ENSP00000465655.1Re-query CCDS DB by Nucleotide ID:ENST00000589123Re-query CCDS DB by Protein ID:ENSP00000465655
Original member NCBI NM_205843.2 NP_995315.1 Updated not alive Link to Nucleotide Sequence:NM_205843.2Link to Protein Sequence:NP_995315.1Re-query CCDS DB by Nucleotide ID:NM_205843Re-query CCDS DB by Protein ID:NP_995315
Current member NCBI NM_205843.3 NP_995315.1 Accepted alive Link to Nucleotide Sequence:NM_205843.3Link to Protein Sequence:NP_995315.1Re-query CCDS DB by Nucleotide ID:NM_205843Re-query CCDS DB by Protein ID:NP_995315Link to BLAST:NP_995315.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_995315.1 499 P08651-2 499 100% 0 0

Chromosomal Locations for CCDS 45914.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 3359683 3359685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3381712 3382243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3425106 3425177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3433518 3433592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3434277 3434400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3435083 3435207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3449014 3449139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3452482 3452666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3453763 3453916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3456550 3456635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3462752 3462769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1500 nt):
ATGGATGAGTTCCACCCGTTCATCGAGGCCCTGCTGCCTCACGTCCGCGCCTTCGCCTACACCTGGTTCA
AC
CTGCAGGCGCGGAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGGATGTCGAAGGACGAGGAGCGTGC
G
GTCAAGGACGAGCTGCTGGGCGAGAAGCCCGAGGTCAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAG
CTG
CGCAAGGACATCCGGCCCGAGTGCCGCGAGGACTTCGTGCTGAGCATCACCGGCAAGAAGGCGCCGG
GC
TGCGTGCTCTCCAACCCCGACCAGAAGGGCAAGATGCGGCGCATCGACTGTCTCCGGCAGGCGGACAA
G
GTGTGGCGGCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCGCTGGAGAGCACCGACGGCGAG
CGC
CTGGTCAAGGCTGCGCAGTGCGGTCACCCGGTCCTGTGCGTGCAGCCGCACCACATTGGCGTGGCCG
TC
AAGGAGCTGGACCTCTACCTGGCCTACTTCGTGCGTGAGCGAGATGCAGAGCAAAGCGGCAGTCCCCG
G
ACAGGGATGGGCTCTGACCAGGAGGACAGCAAGCCCATCACGCTGGACACGACCGACTTCCAGGAGAGC
TTT
GTCACCTCCGGCGTGTTCAGCGTCACTGAGCTCATCCAAGTGTCCCGGACACCCGTGGTGACTGGAA
CA
GGACCCAACTTCTCCCTGGGGGAGCTGCAGGGGCACCTGGCATACGACCTGAACCCAGCCAGCACTGG
C
CTCAGAAGAACGCTGCCCAGCACCTCCTCCAGTGGGAGCAAGCGGCACAAATCGGGCTCGATGGAGGAA
GAC
GTGGACACGAGCCCTGGCGGCGATTACTACACTTCGCCCAGCTCGCCCACGAGTAGCAGCCGCAACT
GG
ACGGAGGACATGGAAGGAGGCATCTCGTCCCCGGTGAAGAAGACAGAGATGGACAAGTCACCATTCAA
C
AGCCCGTCCCCCCAGGACTCTCCCCGCCTCTCCAGCTTCACCCAGCACCACCGGCCCGTCATCGCCGTG
CAC
AGCGGGATCGCCCGGAGCCCACACCCGTCCTCCGCTCTGCATTTCCCTACGACGTCCATCCTACCCC
AG
ACGGCCTCCACCTACTTCCCCCACACGGCCATCCGCTACCCACCTCATCTCAACCCCCAGGACCCGCT
C
AAAGATCTTGTCTCGCTGGCCTGCGACCCAGCCAGCCAGCAACCTGGACCGTTAAATGGAAGTGGTCAG
CTC
AAAATGCCCAGCCACTGCCTTTCTGCTCAGATGCTGGCACCTCCGCCCCCGGGGCTGCCACGGCTGG
CG
CTCCCCCCTGCCACCAAACCCGCCACCACCTCCGAGGGAGGAGCCACGTCGCCGACCTCGCCTTCCTA
C
TCTCCGCCCGACACGTCCCCTGCAAACCGTTCCTTTGTGGGATTAGGACCAAGGGATCCTGCGGGCATT
TAT
CAGGCACAGTCCTGGTATCTGGGATAG


Translation (499 aa):
MDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVKQKWASRLLAK
L
RKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGE
R
LVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRER
DAEQSGSPRTGMGSDQEDSKPITLDTTDFQES
F
VTSGVFSVTELIQVSR
TPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEE
D
VDTSPGGDYYTSPSSPTSSSRNWTEDMEG
GISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAV
H
S
GIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGSGQ
L
KMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSP
SYSPPDTSPANRSFVGLGPRDPAGI
Y
QAQ
SWYLG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser