NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS45792.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45792.1 Public Homo sapiens 17 SEPT9 22 109 92 CCDS HistoryNCBI Gene:10801Re-query CCDS DB by CCDS ID:45792.1Re-query CCDS DB by GeneID:10801See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45792.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000423034.6 ENSP00000405877.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000423034.6Link to Ensembl Protein Viewer:ENSP00000405877.1Re-query CCDS DB by Nucleotide ID:ENST00000423034Re-query CCDS DB by Protein ID:ENSP00000405877
Original member Current member NCBI NM_001113493.1 NP_001106965.1 Accepted alive Link to Nucleotide Sequence:NM_001113493.1Link to Protein Sequence:NP_001106965.1Re-query CCDS DB by Nucleotide ID:NM_001113493Re-query CCDS DB by Protein ID:NP_001106965Link to BLAST:NP_001106965.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001106965.1 579 Q9UHD8-5 579 100% 0 0

Chromosomal Locations for CCDS 45792.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 77373498 77373552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77402059 77402703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77482144 77482335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77487424 77487552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77488240 77488321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77488727 77488864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77490742 77490859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77492621 77492716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77492980 77493076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77497315 77497366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 77498523 77498658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1740 nt):
ATGTCGGACCCCGCGGTCAACGCGCAGCTGGATGGGATCATTTCGGACTTCGAAGCCTTGAAAAGATCTT
TT
GAGGTCGAGGAGGTCGAGACACCCAACTCCACCCCACCCCGGAGGGTCCAGACTCCCCTACTCCGAGC
C
ACTGTGGCCAGCTCCACCCAGAAATTCCAGGACCTGGGCGTGAAGAACTCAGAACCCTCGGCCCGCCAT
GTG
GACTCCCTAAGCCAACGCTCCCCCAAGGCGTCCCTGCGGAGGGTGGAGCTCTCGGGCCCCAAGGCGG
CC
GAGCCGGTGTCCCGGCGCACTGAGCTGTCCATTGACATCTCGTCCAAGCAGGTGGAGAACGCCGGGGC
C
ATCGGCCCGTCCCGGTTCGGGCTCAAGAGGGCCGAGGTGTTGGGCCACAAGACGCCAGAACCGGCCCCT
CGG
AGGACGGAGATCACCATCGTCAAACCCCAGGAGTCAGCCCACCGGAGGATGGAGCCCCCTGCCTCCA
AG
GTCCCCGAGGTGCCCACTGCCCCTGCCACCGACGCAGCCCCCAAGAGGGTGGAGATCCAGATGCCCAA
G
CCTGCTGAGGCGCCCACCGCCCCCAGCCCAGCCCAGACCTTGGAGAATTCAGAGCCTGCCCCTGTGTCT
CAG
CTGCAGAGCAGGCTGGAGCCCAAGCCCCAGCCCCCTGTGGCTGAGGCTACACCCCGGAGCCAGGAGG
CC
ACTGAGGCGGCTCCCAGCTGCGTTGGCGACATGGCCGACACCCCCAGAGATGCCGGGCTCAAGCAGGC
G
CCTGCATCACGGAACGAGAAGGCCCCGGTGGACTTCGGCTACGTGGGGATTGACTCCATCCTGGAGCAG
ATG
CGCCGGAAGGCCATGAAGCAGGGCTTCGAGTTCAACATCATGGTGGTCGGGCAGAGCGGCTTGGGTA
AA
TCCACCTTAATCAACACCCTCTTCAAATCCAAAATCAGCCGGAAGTCGGTGCAGCCCACCTCAGAGGA
G
CGCATCCCCAAGACCATCGAGATCAAGTCCATCACGCACGATATTGAGGAGAAAGGCGTCCGGATGAAG
CTG
ACAGTGATTGACACACCAGGGTTCGGGGACCACATCAACAACGAGAACTGCTGGCAGCCCATCATGA
AG
TTCATCAATGACCAGTACGAGAAATACCTGCAGGAGGAGGTCAACATCAACCGCAAGAAGCGCATCCC
G
GACACCCGCGTCCACTGCTGCCTCTACTTCATCCCCGCCACCGGCCACTCCCTCAGGCCCCTGGACATC
GAG
TTTATGAAACGCCTGAGCAAGGTGGTCAACATCGTCCCTGTCATCGCCAAGGCGGACACACTCACCC
TG
GAGGAGAGGGTCCACTTCAAACAGCGGATCACCGCAGACCTGCTGTCCAACGGCATCGACGTGTACCC
C
CAGAAGGAATTTGATGAGGACTCGGAGGACCGGCTGGTGAACGAGAAGTTCCGGGAGATGATCCCATTT
GCT
GTGGTGGGCAGTGACCACGAGTACCAGGTCAACGGCAAGAGGATCCTTGGGAGGAAGACCAAGTGGG
GT
ACCATCGAAGTTGAAAACACCACACACTGTGAGTTTGCCTACCTGCGGGACCTTCTCATCAGGACGCA
C
ATGCAGAACATCAAGGACATCACCAGCAGCATCCACTTCGAGGCGTACCGTGTGAAGCGCCTCAACGAG
GGC
AGCAGCGCCATGGCCAACGGCATGGAGGAGAAGGAGCCAGAAGCCCCGGAGATGTAG


Translation (579 aa):
MSDPAVNAQLDGIISDFEALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKNSEPSARH
V
DSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAP
R
RTEITIVKPQESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVS
Q
LQSRLEPKPQPPVAEATPRSQE
ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQ
M
RRKAMKQGFEFNIMVV
GQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMK
L
TVIDTPGFGDHINNEN
CWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDI
E
FMKRLSKVVNIVPVIAKADTLTLEERVHFKQR
ITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPF
A
VVGSDHEYQVNGKRILGRKTKWGTIE
VENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNE
G
SSAMANGMEEKEPEAPEM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser