NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4552.1 Public Homo sapiens 6 MRS2 20 108 85 CCDS HistoryNCBI Gene:57380Re-query CCDS DB by CCDS ID:4552.1Re-query CCDS DB by GeneID:57380See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000378386 ENSP00000367637 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378386Link to Ensembl Protein Viewer:ENSP00000367637Re-query CCDS DB by Nucleotide ID:ENST00000378386Re-query CCDS DB by Protein ID:ENSP00000367637
Original member Current member EBI,WTSI OTTHUMT00000040002 OTTHUMP00000016085 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000040002Link to Vega Protein Viewer:OTTHUMP00000016085Re-query CCDS DB by Nucleotide ID:OTTHUMT00000040002Re-query CCDS DB by Protein ID:OTTHUMP00000016085
Original member Current member NCBI NM_020662.3 NP_065713.1 Accepted alive Link to Nucleotide Sequence:NM_020662.3Link to Protein Sequence:NP_065713.1Re-query CCDS DB by Nucleotide ID:NM_020662Re-query CCDS DB by Protein ID:NP_065713Link to BLink:NP_065713.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065713.1 443 Q9HD23-1 443 100% 0 0

Chromosomal Locations for CCDS 4552.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 24403047 24403236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24405168 24405241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24408408 24408444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24409461 24409573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24412222 24412395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24415033 24415163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24416397 24416513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24418084 24418236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24418461 24418578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24422937 24423050 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 24423584 24423694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1332 nt):
ATGGAATGCCTGCGCAGTTTACCCTGCCTCCTGCCCCGCGCGATGAGACTTCCCCGGCGGACGCTGTGTG
CC
CTGGCCTTGGACGTGACCTCTGTGGGTCCTCCCGTTGCTGCCTGCGGCCGCCGAGCCAACCTGATTGG
A
AGGAGCCGAGCGGCGCAGCTTTGCGGGCCCGACCGGCTCCGCGTGGCAGGTGAAGTGCACCGGTTTAGA
ACC
TCTGACGTCTCTCAAGCCACTTTAGCCAGTGTAGCCCCAGTATTTACTGTGACAAAATTTGACAAAC
AG
GGAAACGTTACTTCTTTTGAAAGGAAGAAAACTGAATTATACCAAGAGTTAGGTCTTCAAGCCAGAGA
T
TTGAGATTTCAGCATGTAATGAGTATCACAGTCAGAAACAATAGGATTATCATGAGAATGGAGTATTTG
AAA
GCTGTGATAACTCCAGAGTGTCTTCTGATATTAGATTATCGTAATTTAAACTTAGAGCAATGGCTGT
TC
CGGGAACTCCCTTCACAGTTGTCTGGAGAGGGTCAACTCGTTACATACCCTTTACCTTTTGAGTTTAG
A
GCTATAGAAGCACTCCTGCAATATTGGATCAACACCCTTCAGGGGAAACTTAGCATTTTGCAGCCACTG
ATC
CTTGAGACCTTGGATGCTTTGGTGGACCCCAAACATTCTTCTGTAGACAGAAGCAAACTGCACATTT
TA
CTACAGAATGGCAAAAGTCTATCAGAGTTAGAAACAGATATTAAAATTTTCAAAGAGTCAATTTTGGA
G
ATCTTGGATGAGGAAGAGTTGCTAGAAGAGCTCTGTGTATCAAAATGGAGTGACCCACAAGTCTTTGAA
AAG
AGCAGTGCTGGGATTGACCATGCAGAAGAGATGGAGTTGCTGTTGGAAAACTACTACCGATTGGCTG
AC
GATCTCTCCAATGCAGCTCGTGAGCTTAGGGTGCTGATTGATGATTCACAAAGTATTATTTTCATTAA
T
CTGGACAGCCACCGAAACGTGATGATGAGGTTGAATCTACAGCTGACCATGGGAACCTTCTCTCTTTCG
CTC
TTTGGACTAATGGGAGTTGCTTTTGGAATGAATTTGGAATCTTCCCTTGAAGAGGACCATAGAATTT
TT
TGGCTGATTACAGGAATTATGTTCATGGGAAGTGGCCTCATCTGGAGGCGCCTGCTTTCATTCCTTGG
A
CGACAGCTAGAAGCTCCATTGCCTCCTATGATGGCTTCTTTACCTAAAAAGACTCTTCTGGCAGATAGA
AGC
ATGGAATTGAAAAATAGCCTCAGACTGGATGGACTTGGATCAGGAAGGAGCATCCTAACAAACCGTT
AG


Translation (443 aa):
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFR
T
SDVSQATLASVAPVFTV
TKFDKQGNVTSFERKKTELYQELGLQARDLRFQHVMSITVRNNRIIMRMEYL
K
AVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYW
INTLQGKLSILQPL
I
LETLDALVDPKHSSVDRSKLHILLQNGK
SLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFE
K
SSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLD
SHRNVMMRLNLQLTMGTFSLS
L
FGLMGVAFGMNLESSLEE
DHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR
S
MELKNSLRLDGLGSGRSILTNR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser