NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45326.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45326.1 Public Homo sapiens 15 GOLGA6L9 22 109 92 CCDS HistoryNCBI Gene:440295Re-query CCDS DB by CCDS ID:45326.1Re-query CCDS DB by GeneID:440295See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 45326.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000618348.1 ENSP00000481078.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000618348.1Link to Ensembl Protein Viewer:ENSP00000481078.1Re-query CCDS DB by Nucleotide ID:ENST00000618348Re-query CCDS DB by Protein ID:ENSP00000481078
Original member Current member NCBI NM_198181.3 NP_937824.3 Accepted alive Link to Nucleotide Sequence:NM_198181.3Link to Protein Sequence:NP_937824.3Re-query CCDS DB by Nucleotide ID:NM_198181Re-query CCDS DB by Protein ID:NP_937824Link to BLAST:NP_937824.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_937824.3 432 A6NEM1-1 432 100% 0 0

Chromosomal Locations for CCDS 45326.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 82430080 82430163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82431830 82431949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82432572 82432631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82432817 82432897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82433562 82433649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82434034 82434602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82434869 82434929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82435967 82436069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82436279 82436411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1299 nt):
ATGTGGCCCCAACCCCGCCTCCCTCCCCACCCCGCGATGTCAGAAAAAACACAACAGGGGAAATTGGCCG
CA
GCCAAGAAAAAGTTAAAAGCATATTGGCAGAGGAAGAGCCCTGGCATTCCAGCAGGAGCTAACAGGAA
A
AAGAAAATCAATGGCAGTAGCCCTGACACATTCACTTCTGGTGGTTACCACTCACCTGGGGATTCAGCA
ACA
GGTATCTACGGGGAGGGCCGTGCATCCTCTACTACCCTGCAGGATCTGGAGAGCCAGTACCAAGAAC
TA
GCAGTAGCCCTGGATTCAAGCTCCGCAATAATCAGTCAACTCACTGAAAACATCAATTCACTGGTTCG
C
ACATCTAAGGAGGAGAAGAAGCATGAGATACATCTGGTACAGAAGCTTGGGAGGAGCTTGTTCAAACTC
AAA
AACCAGACGGCTGAACCCCTGGCCCCACAGCCCCCAGCAGGGCCATCTAAGATGGAGCAGCTACAAG
AT
GAGACCAACCACCTAAGGAAGGAGCTAGAGAGTGTGGGAAGACAGCTCCAGGCTGAGGTGGAAAACAA
T
CAGATGTTGAGTCTCCTGAACAGGAGACAGGAGGAGAGGCTACGTGAACAGGAGGAGAGGCTACGTGAA
CAG
GAGGAGAGGCTGTGTGAACAGGAGGAGAGGCTGTGTGAACAGGAGGAGAGGCTACGTGAACAGGAGG
AG
AGGCTGTGTGAACAGGAGAAGCTGCCAGGGCAGGAGAGGCTGCTGGAAGAGGTGGAGAAGCTGTTAGA
A
CAGGAGAGGCGGCAGGAGGAGCAGGAGAGGCTGCTGGAGAGGGAGAGGCTGCTGGACGAGGTGGAGGAG
CTC
CTGGAGCAGGAGAGGCTTCGGCAACAGGATGAGAGGCTGTGGCAGCAGGAGACTCTGCGGGAGCTGG
AG
AGGCTGCGGGAGCTGGAGAGGATGCTGGAGCTGGGGTGGGAAGCCCTGTACGAGCAGCGGGCCGAGCC
A
CGCAGCGGCTTCGAGGAGCTGAACAACGAGAACAAGAGCACACTGCAGTTGGAGCAGCAAGTAAAGGAG
CTG
GAGAAGTCGGGTGGAGCTGAAGAGCCAAGAGGCTCCGAGTCTGCAGCAGCAGCCAGACCAGTAGCTG
GA
GCCCCAGTCCCACAAGGAGCTTGGATGTGCGGACAAGCAGGGTGGACTCCCCAGGAGCACCCAGGCTT
G
AGTGGAGAAGCTGTTGGTACAGGAGAGGCGGCAGGAGGAGCAGGAGAGGCTGCATGCCATTCTTTTCGG
GCT
GCCGAGAACAGGGAGCTAAACATCACCATCATCTAA


Translation (432 aa):
MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSPDTFTSGGYHSPGDSA
T
GIYGEGRASSTTLQDLE
SQYQELAVALDSSSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKL
K
NQT
AEPLAPQPPAGPSKMEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEERLREQEERLRE
Q
EERLCEQEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLDEVEE
L
LEQERLRQQDERLWQQETLRELERLRELERMLELGWEALYEQRAEPRSGFEEL
NNENKSTLQLEQQVKE
L
EKS
GGAEEPRGSESAAAARPVAGAPVPQGAWMCGQAGWTPQEHPGLSGEAVGTGEAAGGAGEAACHSFR
A
AENRELNITII




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser