NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS44971.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44971.1 Public Homo sapiens 12 ANAPC7 22 109 92 CCDS HistoryNCBI Gene:51434Re-query CCDS DB by CCDS ID:44971.1Re-query CCDS DB by GeneID:51434See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44971.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000450008.2 ENSP00000402314.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450008.2Link to Ensembl Protein Viewer:ENSP00000402314.2Re-query CCDS DB by Nucleotide ID:ENST00000450008Re-query CCDS DB by Protein ID:ENSP00000402314
Original member Current member NCBI NM_001137664.1 NP_001131136.1 Accepted alive Link to Nucleotide Sequence:NM_001137664.1Link to Protein Sequence:NP_001131136.1Re-query CCDS DB by Nucleotide ID:NM_001137664Re-query CCDS DB by Protein ID:NP_001131136Link to BLAST:NP_001131136.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001131136.1 537 Q9UJX3-2 537 100% 0 0

Chromosomal Locations for CCDS 44971.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 110376062 110376216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110377393 110377617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110381752 110381948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110382843 110382960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110386327 110386469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110387739 110387892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110388512 110388623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110395101 110395220 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110396266 110396452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 110403527 110403729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1614 nt):
ATGGACCCCGGCGACGCCGCCATTTTGGAGTCTTCCCTAAGGATCCTCTACCGGCTTTTCGAGTCAGTGC
TG
CCGCCGCTGCCCGCGGCTTTGCAGAGCAGGATGAATGTGATAGACCACGTGCGGGACATGGCGGCCGC
G
GGGCTGCACTCCAACGTGCGGCTCCTCAGCAGCTTGTTACTTACAATGAGTAATAACAACCCTGAGTTA
TTC
TCCCCACCTCAGAAGTACCAGCTTTTGGTGTATCATGCAGATTCTCTCTTTCATGATAAGGAATATC
GG
AATGCTGTGAGTAAGTATACCATGGCTTTACAGCAGAAGAAAGCGCTAAGTAAAACTTCAAAAGTGAG
A
CCTTCAACTGGAAATTCTGCATCTACTCCACAAAGTCAGTGTCTTCCATCTGAAATTGAAGTGAAATAC
AAA
ATGGCTGAATGTTATACAATGCTAAAACAAGATAAAGATGCCATTGCTATACTTGATGGGATCCCTT
CA
AGACAAAGAACTCCCAAAATAAACATGATGCTGGCAAACCTGTACAAGAAGGCTGGTCAGGAGCGCCC
T
TCAGTCACCAGCTATAAGGAGGTGCTGAGGCAGTGCCCATTAGCCCTTGATGCCATTCTAGGCTTGTTG
TCC
CTTTCTGTAAAAGGGGCAGAGGTGGCATCCATGACAATGAATGTGATCCAAACCGTGCCTAACTTGG
AC
TGGCTCTCTGTGTGGATCAAAGCGTATGCTTTTGTGCACACTGGTGACAACTCAAGAGCAATCAGTAC
C
ATCTGTTCACTAGAGAAAAAATCCTTATTGCGAGATAACGTGGACCTATTGGGAAGCTTGGCAGATCTG
TAC
TTCAGAGCTGGAGACAATAAAAACTCTGTCCTCAAGTTTGAACAGGCACAGATGTTGGATCCTTATC
TG
ATAAAAGGAATGGATGTATATGGCTACCTACTGGCACGAGAAGGGCGGCTAGAGGATGTTGAGAACCT
T
GGATGCCGCCTTTTCAATATCTCTGATCAGCATGCAGAACCGTGGGTGGTTTCTGGCTGTCACAGCTTC
TAT
AGCAAACGCTACTCCCGGGCCCTCTATTTAGGAGCCAAGGCCATTCAGCTGAACAGTAATAGTGTTC
AA
GCTCTGCTACTTAAGGGAGCAGCACTTAGGAACATGGGCAGAGTCCAAGAAGCAATAATCCACTTTCG
G
GAGGCCATACGGCTCGCACCTTGTCGCTTAGATTGTTATGAAGGTCTTATCGAATGTTACTTAGCCTCC
AAC
AGTATTCGAGAAGCAATGGTAATGGCTAACAACGTTTACAAAACTCTGGGAGCAAATGCACAGACCC
TT
ACCCTTTTAGCCACCGTTTGTCTTGAAGACCCAGTGACACAGGAGAAAGCCAAAACATTATTAGATAA
A
GCCCTGACCCAAAGGCCAGATTACATTAAGGCTGTGGTGAAAAAAGCAGAACTACTTAGCAGAGAACAG
AAA
TATGAAGATGGAATTGCTTTGCTGAGGAACGCACTGGCTAATCAGAGTGACTGTGTCCTGCATCGGA
TC
CTAGGAGATTTCCTTGTAGCTGTCAATGAGTATCAGGAGGCAATGGACCAGTATAGTATAGCACTAAG
G
TAG


Translation (537 aa):
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEL
F
SPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQ
CLPSEIEVKY
K
MAECYTMLKQDKDAIAILDGIPSRQRTPK
INMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLL
S
LSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTI
CSLEKKSLLRDNVDLLGSLADL
Y
FRAGDNKNSVLKFEQAQMLDPYLIK
GMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSF
Y
SKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYE
GLIECYLAS
N
SIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELL
SREQ
K
YEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser