NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS44961.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44961.1 Public Homo sapiens 12 IGF1 22 109 92 CCDS HistoryNCBI Gene:3479Re-query CCDS DB by CCDS ID:44961.1Re-query CCDS DB by GeneID:3479See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44961.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000392904.5 ENSP00000376637.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392904.5Link to Ensembl Protein Viewer:ENSP00000376637.1Re-query CCDS DB by Nucleotide ID:ENST00000392904Re-query CCDS DB by Protein ID:ENSP00000376637
Original member Current member EBI,WTSI ENST00000392905.7 ENSP00000376638.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392905.7Link to Ensembl Protein Viewer:ENSP00000376638.3Re-query CCDS DB by Nucleotide ID:ENST00000392905Re-query CCDS DB by Protein ID:ENSP00000376638
Original member NCBI NM_001111283.2 NP_001104753.1 Updated not alive Link to Nucleotide Sequence:NM_001111283.2Link to Protein Sequence:NP_001104753.1Re-query CCDS DB by Nucleotide ID:NM_001111283Re-query CCDS DB by Protein ID:NP_001104753
Current member NCBI NM_001111283.3 NP_001104753.1 Accepted alive Link to Nucleotide Sequence:NM_001111283.3Link to Protein Sequence:NP_001104753.1Re-query CCDS DB by Nucleotide ID:NM_001111283Re-query CCDS DB by Protein ID:NP_001104753Link to BLAST:NP_001104753.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001104753.1 158 P05019-4 158 100% 0 0

Chromosomal Locations for CCDS 44961.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 102402541 102402566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102417955 102418003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102419509 102419690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102475643 102475799 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102480319 102480381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (477 nt):
ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGA
TG
CACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCAC
G
GCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGC
TTT
TATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATG
AG
TGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTC
A
GCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGTATCAGCCCCCATCTACC
AAC
AAGAACACGAAGTCTCAGAGAAGGAAAGGAAGTACATTTGAAGAACGCAAGTAG


Translation (158 aa):
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRG
F
YF
NKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPST
N
KNTKSQRRK
GSTFEERK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser