NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4482.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4482.1 Public Homo sapiens 6 RIPK1 20 108 85 CCDS HistoryNCBI Gene:8737Re-query CCDS DB by CCDS ID:4482.1Re-query CCDS DB by GeneID:8737See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4482.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000259808 ENSP00000259808 Accepted alive Link to Ensembl Transcript Viewer:ENST00000259808Link to Ensembl Protein Viewer:ENSP00000259808Re-query CCDS DB by Nucleotide ID:ENST00000259808Re-query CCDS DB by Protein ID:ENSP00000259808
Original member Current member EBI,WTSI ENST00000380409 ENSP00000369773 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380409Link to Ensembl Protein Viewer:ENSP00000369773Re-query CCDS DB by Nucleotide ID:ENST00000380409Re-query CCDS DB by Protein ID:ENSP00000369773
Original member Current member EBI,WTSI OTTHUMT00000039659 OTTHUMP00000015955 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000039659Link to Vega Protein Viewer:OTTHUMP00000015955Re-query CCDS DB by Nucleotide ID:OTTHUMT00000039659Re-query CCDS DB by Protein ID:OTTHUMP00000015955
Original member Current member NCBI NM_003804.4 NP_003795.2 Accepted alive Link to Nucleotide Sequence:NM_003804.4Link to Protein Sequence:NP_003795.2Re-query CCDS DB by Nucleotide ID:NM_003804Re-query CCDS DB by Protein ID:NP_003795Link to BLink:NP_003795.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003795.2 671 Q13546-1 671 100% 0 0

Chromosomal Locations for CCDS 4482.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 3076824 3076987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3077779 3077935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3080979 3081116 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3083085 3083313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3085259 3085408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3089581 3089657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3104225 3104315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3105482 3106051 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3110803 3110955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 3113053 3113339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2016 nt):
ATGCAACCAGACATGTCCTTGAATGTCATTAAGATGAAATCCAGTGACTTCCTGGAGAGTGCAGAACTGG
AC
AGCGGAGGCTTTGGGAAGGTGTCTCTGTGTTTCCACAGAACCCAGGGACTCATGATCATGAAAACAGT
G
TACAAGGGGCCCAACTGCATTGAGCACAACGAGGCCCTCTTGGAGGAGGCGAAGATGATGAACAGACTG
AGA
CACAGCCGGGTGGTGAAGCTCCTGGGCGTCATCATAGAGGAAGGGAAGTACTCCCTGGTGATGGAGT
AC
ATGGAGAAGGGCAACCTGATGCACGTGCTGAAAGCCGAGATGAGTACTCCGCTTTCTGTAAAAGGAAG
G
ATAATTTTGGAAATCATTGAAGGAATGTGCTACTTACATGGAAAAGGCGTGATACACAAGGACCTGAAG
CCT
GAAAATATCCTTGTTGATAATGACTTCCACATTAAGATCGCAGACCTCGGCCTTGCCTCCTTTAAGA
TG
TGGAGCAAACTGAATAATGAAGAGCACAATGAGCTGAGGGAAGTGGACGGCACCGCTAAGAAGAATGG
C
GGCACCCTCTACTACATGGCGCCCGAGCACCTGAATGACGTCAACGCAAAGCCCACAGAGAAGTCGGAT
GTG
TACAGCTTTGCTGTAGTACTCTGGGCGATATTTGCAAATAAGGAGCCATATGAAAATGCTATCTGTG
AG
CAGCAGTTGATAATGTGCATAAAATCTGGGAACAGGCCAGATGTGGATGACATCACTGAGTACTGCCC
A
AGAGAAATTATCAGTCTCATGAAGCTCTGCTGGGAAGCGAATCCGGAAGCTCGGCCGACATTTCCTGGC
ATT
GAAGAAAAATTTAGGCCTTTTTATTTAAGTCAATTAGAAGAAAGTGTAGAAGAGGACGTGAAGAGTT
TA
AAGAAAGAGTATTCAAACGAAAATGCAGTTGTGAAGAGAATGCAGTCTCTTCAACTTGATTGTGTGGC
A
GTACCTTCAAGCCGGTCAAATTCAGCCACAGAACAGCCTGGTTCACTGCACAGTTCCCAGGGACTTGGG
ATG
GGTCCTGTGGAGGAGTCCTGGTTTGCTCCTTCCCTGGAGCACCCACAAGAAGAGAATGAGCCCAGCC
TG
CAGAGTAAACTCCAAGACGAAGCCAACTACCATCTTTATGGCAGCCGCATGGACAGGCAGACGAAACA
G
CAGCCCAGACAGAATGTGGCTTACAACAGAGAGGAGGAAAGGAGACGCAGGGTCTCCCATGACCCTTTT
GCA
CAGCAAAGACCTTACGAGAATTTTCAGAATACAGAGGGAAAAGGCACTGCTTATTCCAGTGCAGCCA
GT
CATGGTAATGCAGTGCACCAGCCCTCAGGGCTCACCAGCCAACCTCAAGTACTGTATCAGAACAATGG
A
TTATATAGCTCACATGGCTTTGGAACAAGACCACTGGATCCAGGAACAGCAGGTCCCAGAGTTTGGTAC
AGG
CCAATTCCAAGTCATATGCCTAGTCTGCATAATATCCCAGTGCCTGAGACCAACTATCTAGGAAATA
CA
CCCACCATGCCATTCAGCTCCTTGCCACCAACAGATGAATCTATAAAATATACCATATACAATAGTAC
T
GGCATTCAGATTGGAGCCTACAATTATATGGAGATTGGTGGGACGAGTTCATCACTACTAGACAGCACA
AAT
ACGAACTTCAAAGAAGAGCCAGCTGCTAAGTACCAAGCTATCTTTGATAATACCACTAGTCTGACGG
AT
AAACACCTGGACCCAATCAGGGAAAATCTGGGAAAGCACTGGAAAAACTGTGCCCGTAAACTGGGCTT
C
ACACAGTCTCAGATTGATGAAATTGACCATGACTATGAGCGAGATGGACTGAAAGAAAAGGTTTACCAG
ATG
CTCCAAAAGTGGGTGATGAGGGAAGGCATAAAGGGAGCCACGGTGGGGAAGCTGGCCCAGGCGCTCC
AC
CAGTGTTCCAGGATCGACCTTCTGAGCAGCTTGATTTACGTCAGCCAGAACTAA


Translation (671 aa):
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL
R
HSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAE
MSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK
P
ENILVDNDFHIK
IADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD
V
YSFAVVLWAIFANKEPYE
NAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPG
I
EEKFRPFYLSQLEESVEEDVKSLK
KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG
M
GPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
A
QQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY
R
PIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPT
DESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDST
N
TNFKEEPAAKYQAIF
DNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQ
M
LQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser