NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44705.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44705.1 Public Homo sapiens 11 CHORDC1 22 109 92 CCDS HistoryNCBI Gene:26973Re-query CCDS DB by CCDS ID:44705.1Re-query CCDS DB by GeneID:26973See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44705.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000457199.6 ENSP00000401080.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000457199.6Link to Ensembl Protein Viewer:ENSP00000401080.2Re-query CCDS DB by Nucleotide ID:ENST00000457199Re-query CCDS DB by Protein ID:ENSP00000401080
Original member Current member NCBI NM_001144073.1 NP_001137545.1 Accepted alive Link to Nucleotide Sequence:NM_001144073.1Link to Protein Sequence:NP_001137545.1Re-query CCDS DB by Nucleotide ID:NM_001144073Re-query CCDS DB by Protein ID:NP_001137545Link to BLAST:NP_001137545.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001137545.1 313 Q9UHD1-2 313 100% 0 0

Chromosomal Locations for CCDS 44705.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 90202405 90202551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90202813 90202875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90203308 90203427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90205460 90205565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90206202 90206272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90210536 90210594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90211215 90211318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90214018 90214175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90218135 90218184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 90222891 90222954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (942 nt):
ATGGCCTTGCTGTGCTACAACCGGGGCTGCGGTCAGCGCTTCGATCCTGAGACCAATTCCGACGATGCTT
GC
ACATACCACCCAGGTGTTCCGGTCTTTCACGATGCATTAAAGGGCTGTACAAAAGGTAGACATAATAG
T
GAGAAGCCACCTGAGCCAGTCAAACCTGAAGTCAAGACTACTGAGAAGAAGGAGCTATGTGAATTAAAA
CCC
AAATTTCAGGAACACATCATTCAAGCCCCTAAGCCAGTAGAAGCAATAAAAAGACCAAGCCCAGATG
AA
CCAATGACAAATTTGGAATTAAAAATATCTGCCTCCCTAAAACAAGCACTTGATAAACTTAAACTGTC
A
TCAGGGAATGAAGAAAATAAGAAAGAAGAAGACAATGATGAAATTAAGATTGGGACCTCATGTAAGAAT
GGA
GGGTGTTCAAAGACATACCAGGGTCTAGAGAGTCTAGAAGAAGTCTGTGTATATCATTCTGGAGTAC
CT
ATTTTCCATGAGGGGATGAAATACTGGAGCTGTTGTAGAAGAAAAACTTCTGATTTTAATACATTCTT
A
GCCCAAGAGGGCTGTACAAAAGGGAAACACATGTGGACTAAAAAAGATGCTGGGAAAAAAGTTGTTCCA
TGT
AGACATGACTGGCATCAGACTGGAGGTGAAGTTACCATTTCAGTATATGCTAAAAACTCACTTCCAG
AA
CTTAGCCGAGTAGAAGCAAATAGCACATTGTTAAATGTGCATATTGTATTTGAAGGAGAGAAGGAATT
T
GATCAAAATGTGAAATTATGGGGTGTGATTGATGTAAAGCGAAGTTATGTAACTATGACTGCAACAAAG
ATT
GAAATCACTATGAGAAAAGCTGAACCGATGCAGTGGGCAAGCCTTGAACTGCCTGCAGCTAAAAAGC
AG
GAAAAACAAAAAGATGCCACAACAGATTGA


Translation (313 aa):
MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGCTKGRHNSEKPPEPVKPEVKTTEKKELCELK
P
KFQEHIIQAPKPVEAIKRP
SPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKN
G
GCSK
TYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
C
RHDWHQTGGEVTISVYAKNSLPELSRVEANSTL
LNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATK
I
EITMRKAEPMQWASLELPAAKKQEKQKDATTD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser