NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS44624.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44624.1 Public Homo sapiens 11 INCENP 22 109 92 CCDS HistoryNCBI Gene:3619Re-query CCDS DB by CCDS ID:44624.1Re-query CCDS DB by GeneID:3619See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44624.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000394818.7 ENSP00000378295.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394818.7Link to Ensembl Protein Viewer:ENSP00000378295.3Re-query CCDS DB by Nucleotide ID:ENST00000394818Re-query CCDS DB by Protein ID:ENSP00000378295
Original member NCBI NM_001040694.1 NP_001035784.1 Updated not alive Link to Nucleotide Sequence:NM_001040694.1Link to Protein Sequence:NP_001035784.1Re-query CCDS DB by Nucleotide ID:NM_001040694Re-query CCDS DB by Protein ID:NP_001035784
Current member NCBI NM_001040694.2 NP_001035784.1 Accepted alive Link to Nucleotide Sequence:NM_001040694.2Link to Protein Sequence:NP_001035784.1Re-query CCDS DB by Nucleotide ID:NM_001040694Re-query CCDS DB by Protein ID:NP_001035784Link to BLAST:NP_001035784.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035784.1 918 Q9NQS7-1 918 100% 0 0

Chromosomal Locations for CCDS 44624.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 62128162 62128301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62128770 62128883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62129782 62130590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62137832 62137883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62138713 62138770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62138888 62139005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62140234 62140285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62140704 62140821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62140913 62141044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62141500 62141511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62144982 62145091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62145169 62145289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62145629 62145751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62146658 62146902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62148476 62148554 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62148739 62148846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62150057 62150207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62151762 62151976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2757 nt):
ATGGGGACGACGGCCCCAGGGCCCATTCACCTGCTGGAGCTATGTGACCAGAAGCTCATGGAGTTTCTCT
GC
AACATGGATAATAAGGACTTGGTGTGGCTTGAGGAAATCCAAGAGGAGGCCGAGCGCATGTTCACCAG
A
GAATTCAGCAAAGAGCCAGAGCTGATGCCCAAAACACCTTCTCAGAAGAACCGACGGAAGAAGAGACGG
ATT
TCTTATGTTCAGGATGAAAACAGAGATCCCATCAGGAGAAGGTTATCCCGCAGAAAGTCTCGGAGCA
GC
CAGCTGAGCTCCCGACGCCTCCGCAGCAAGGACAGTGTAGAGAAGCTGGCTACAGTGGTCGGGGAGAA
C
GGCTCCGTCCTGCGGCGTGTGACCCGTGCTGCGGCTGCAGCTGCCGCGGCTACCATGGCATTGGCTGCA
CCT
TCTTCACCCACCCCTGAGTCTCCCACGATGCTGACTAAGAAGCCCGAGGATAACCACACCCAGTGCC
AG
CTGGTGCCTGTGGTGGAGATCGGCATCAGTGAGCGCCAGAATGCTGAGCAGCATGTCACCCAGCTCAT
G
TCCACCGAGCCTCTGCCCCGCACTCTGTCCCCGACTCCAGCTTCAGCCACAGCTCCAACCTCCCAGGGC
ATC
CCGACATCAGATGAGGAATCAACACCTAAGAAGTCGAAGGCCAGGATACTGGAGTCCATCACAGTGA
GC
TCCCTGATGGCTACACCCCAGGACCCCAAGGGTCAAGGGGTCGGGACGGGGCGGTCTGCGTCTAAGCT
C
AGGATTGCGCAGGTCTCCCCTGGCCCACGGGACTCGCCAGCCTTTCCAGATTCTCCATGGCGGGAGCGG
GTG
CTGGCTCCCATCCTGCCGGATAACTTCTCCACGCCCACGGGCTCTCGCACGGACTCTCAATCGGTGC
GG
CACAGCCCGATCGCCCCGTCTTCCCCGAGTCCCCAAGTCTTAGCCCAGAAGTACTCTCTGGTGGCCAA
A
CAGGAAAGTGTTGTCCGCAGGGCGAGCAGAAGGCTTGCCAAGAAGACTGCCGAAGAGCCAGCTGCCTCT
GGC
CGCATCATCTGTCACAGTTACCTGGAGAGGCTCCTGAATGTTGAGGTGCCCCAGAAAGTTGGTTCTG
AG
CAGAAGGAACCCCCCGAGGAGGCTGAGCCTGTGGCGGCAGCTGAGCCAGAGGTCCCTGAGAACAATGG
A
AATAACTCGTGGCCCCACAATGACACGGAGATTGCCAACAGCACACCCAACCCGAAGCCTGCAGCCAGC
AGC
CCGGAAACACCCTCTGCAGGGCAGCAAGAGGCCAAGACGGACCAAGCAGATGGACCCAGAGAGCCAC
CG
CAGAGTGCCAGGAGGAAGCGCAGCTACAAGCAGGCCGTGAGTGAGCTGGACGAGGAGCAGCACCTGGA
G
GATGAGGAGCTGCAGCCCCCCAGGAGCAAGACCCCTTCCTCACCCTGCCCAGCCAGCAAGGTGGTACGG
CCC
CTCCGGACCTTTCTGCACACAGTGCAGAGGAACCAGATGCTCATGACCCCGACCTCAGCCCCACGCA
GC
GTCATGAAGTCCTTTATTAAGCGCAACACTCCCCTGCGCATGGACCCCAAGTGCAGCTTCGTCGAGAA
G
GAGCGGCAGCGCCTGGAGAATCTGCGGCGGAAGGAGGAGGCCGAGCAGCTGCGCAGGCAGAAGGTGGAG
GAG
GACAAGCGGCGGCGGCTGGAGGAGGTGAAGCTGAAGCGTGAGGAACGCCTCCGCAAGGTGCTGCAGG
CC
CGCGAGCGGGTGGAGCAGATGAAGGAGGAGAAGAAGAAGCAGATTGAGCAGAAGTTTGCTCAGATCGA
C
GAGAAGACTGAGAAGGCCAAGGAGGAGCGGCTGGCAGAGGAGAAGGCCAAGAAAAAGGCGGCGGCCAAG
AAG
ATGGAGGAGGTGGAAGCACGCAGGAAGCAGGAAGAGGAGGCACGTAGGCTCAGGTGGCTGCAGCAGG
AG
GAGGAAGAGCGGCGGCACCAAGAGCTGCTGCAGAAGAAGAAGGAAGAGGAGCAGGAGCGGCTGCGGAA
G
GCGGCCGAGGCTAAGCGGCTGGCAGAGCAGCGGGAGCAGGAGCGGCGGGAGCAGGAGCGGCGCGAGCAG
GAG
CGGCGCGAGCAGGAGCGGCGGGAGCAGGAGCGGCGCGAGCAGGAGCGACAGCTGGCAGAGCAGGAGC
GT
CGGCGGGAGCAGGAGCGGCTCCAGGCCGAGAGGGAGCTGCAGGAGCGGGAGAAGGCCCTGCGGCTGCA
G
AAGGAGCAGCTGCAGAGGGAACTGGAGGAGAAGAAGAAGAAGGAAGAGCAGCAGCGTCTGGCTGAGCGG
CAG
CTGCAGGAGGAGCAAGAGAAGAAAGCCAAGGAGGCAGCAGGGGCCAGCAAGGCCCTGAATGTGACTG
TG
GACGTGCAGTCTCCAGCTTGTACCTCATATCAGATGACTCCGCAAGGGCACAGGGCCCCTCCCAAGAT
C
AACCCAGATAACTACGGGATGGATCTGAATAGCGACGACTCCACCGATGATGAGGCCCATCCCCGGAAG
CCC
ATCCCCACCTGGGCCCGAGGCACCCCGCTCAGCCAGGCTATCATTCACCAGTACTACCACCCACCGA
AC
CTTCTGGAGCTCTTTGGAACCATTCTCCCACTGGACTTGGAGGATATCTTCAAGAAGAGCAAGCCCCG
C
TATCACAAGCGCACCAGCTCTGCTGTCTGGAACTCACCGCCCCTGCAGGGCGCCAGGGTCCCCAGCAGC
CTG
GCCTACAGCCTGAAGAAGCACTGA


Translation (918 aa):
MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRR
I
SYVQDENRDPIRR
RLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAA
P
SSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQG
I
PTSDEESTPKKSKARILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRER
V
LAPILPDNFSTPTGSRTDSQSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAAS
G
RII
CHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS
S
PETPSAGQQ
EAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVR
P
LRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPK
CSFVEKERQRLENLRRKEEAEQLRRQKVE
E
DKRRRLEEVK
LKREERLRKVLQARERVEQMKEEKKKQIEQKFAQIDEKTEKAKEERLAEEKAKKKAAAK
K
MEEVEARRKQEEEARRLRWLQQ
EEEERRHQELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQ
E
RREQERREQERREQERQLAEQERRREQERLQAE
RELQEREKALRLQKEQLQRELEEKKKKEEQQRLAER
Q
LQEEQEKKAKEAAGASKALNVTVDVQ
SPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK
P
IPTWAR
GTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSS
L
AYSLKKH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser