NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44444.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44444.2 Public Homo sapiens 10 SFTPA1 22 109 92 CCDS HistoryNCBI Gene:653509Re-query CCDS DB by CCDS ID:44444.2Re-query CCDS DB by GeneID:653509See the combined annotation on chromosome 10 in Sequence Viewer

Public Note for CCDS 44444.1
The coding region has been updated to represent an alternative splicing pattern that is more supported by the available transcript and protein data.

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 44444.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000419470.6 ENSP00000397082.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419470.6Link to Ensembl Protein Viewer:ENSP00000397082.2Re-query CCDS DB by Nucleotide ID:ENST00000419470Re-query CCDS DB by Protein ID:ENSP00000397082
Original member Current member NCBI NM_001093770.2 NP_001087239.2 Accepted alive Link to Nucleotide Sequence:NM_001093770.2Link to Protein Sequence:NP_001087239.2Re-query CCDS DB by Nucleotide ID:NM_001093770Re-query CCDS DB by Protein ID:NP_001087239Link to BLAST:NP_001087239.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001087239.2 263 Q8IWL2-2 263 100% 0 0

Chromosomal Locations for CCDS 44444.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 79611620 79611641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79611803 79611997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79612312 79612431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79613189 79613266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79613737 79614113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGAGGCCATGCCAGGTGCCAGGAGCAGCGACTGGACCCAGAGCCATGTGGCTGTGCCCTCTGGCCCTCA
AC
CTCATCTTGATGGCAGCCTCTGGTGCTGTGTGCGAAGTGAAGGACGTTTGTGTTGGAAGCCCTGGTAT
C
CCCGGCACTCCTGGATCCCACGGCCTGCCAGGCAGGGACGGGAGAGATGGTCTCAAAGGAGACCCTGGC
CCT
CCAGGCCCCATGGGTCCACCTGGAGAAATGCCATGTCCTCCTGGAAATGATGGGCTGCCTGGAGCCC
CT
GGTATCCCTGGAGAGTGTGGAGAGAAGGGGGAGCCTGGCGAGAGGGGCCCTCCAGGGCTTCCAGCTCA
T
CTAGATGAGGAGCTCCAAGCCACACTCCACGACTTTAGACATCAAATCCTGCAGACAAGGGGAGCCCTC
AGT
CTGCAGGGCTCCATAATGACAGTAGGAGAGAAGGTCTTCTCCAGCAATGGGCAGTCCATCACTTTTG
AT
GCCATTCAGGAGGCATGTGCCAGAGCAGGCGGCCGCATTGCTGTCCCAAGGAATCCAGAGGAAAATGA
G
GCCATTGCAAGCTTCGTGAAGAAGTACAACACATATGCCTATGTAGGCCTGACTGAGGGTCCCAGCCCT
GGA
GACTTCCGCTACTCAGACGGGACCCCTGTAAACTACACCAACTGGTACCGAGGGGAGCCCGCAGGTC
GG
GGAAAAGAGCAGTGTGTGGAGATGTACACAGATGGGCAGTGGAATGACAGGAACTGCCTGTACTCCCG
A
CTGACCATCTGTGAGTTCTGA


Translation (263 aa):
MRPCQVPGAATGPRAMWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPG
P
P
GPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGAL
S
LQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSP
G
DFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser