NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43226.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43226.1 Public Homo sapiens 4 CNGA1 22 109 92 CCDS HistoryNCBI Gene:1259Re-query CCDS DB by CCDS ID:43226.1Re-query CCDS DB by GeneID:1259See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43226.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000358519.8 ENSP00000351320.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000358519.8Link to Ensembl Protein Viewer:ENSP00000351320.4Re-query CCDS DB by Nucleotide ID:ENST00000358519Re-query CCDS DB by Protein ID:ENSP00000351320
Original member Current member EBI,WTSI ENST00000420489.6 ENSP00000389881.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000420489.6Link to Ensembl Protein Viewer:ENSP00000389881.2Re-query CCDS DB by Nucleotide ID:ENST00000420489Re-query CCDS DB by Protein ID:ENSP00000389881
Original member Current member EBI,WTSI ENST00000514170.5 ENSP00000426862.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000514170.5Link to Ensembl Protein Viewer:ENSP00000426862.1Re-query CCDS DB by Nucleotide ID:ENST00000514170Re-query CCDS DB by Protein ID:ENSP00000426862
Original member NCBI NM_000087.3 NP_000078.2 Updated not alive Link to Nucleotide Sequence:NM_000087.3Link to Protein Sequence:NP_000078.2Re-query CCDS DB by Nucleotide ID:NM_000087Re-query CCDS DB by Protein ID:NP_000078
Current member NCBI NM_000087.4 NP_000078.2 Accepted alive Link to Nucleotide Sequence:NM_000087.4Link to Protein Sequence:NP_000078.2Re-query CCDS DB by Nucleotide ID:NM_000087Re-query CCDS DB by Protein ID:NP_000078Link to BLAST:NP_000078.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000078.2 690 P29973-1 690 100% 0 0

Chromosomal Locations for CCDS 43226.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 47936421 47937829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47940763 47940869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47942041 47942148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47943181 47943288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47943371 47943412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47949833 47949895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47951353 47951469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 47952583 47952701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2073 nt):
ATGAAACTATCCATGAAGAACAATATTATCAATACACAGCAGTCTTTTGTAACCATGCCCAATGTGATTG
TA
CCAGATATTGAAAAGGAAATACGAAGGATGGAAAATGGAGCATGCAGCTCCTTTTCTGAGGATGATGA
C
AGTGCCTCTACATCTGAAGAATCAGAGAATGAAAACCCTCATGCAAGGGGTTCCTTTAGTTATAAGTCA
CTC
AGAAAGGGAGGACCATCACAGAGGGAGCAGTACCTGCCTGGTGCCATTGCACTTTTTAATGTGAACA
AC
AGCAGCAATAAGGACCAGGAACCAGAAGAAAAAAAGAAAAAGAAAAAAGAAAAGAAGAGCAAGTCAGA
T
GATAAAAACGAAAATAAAAACGACCCAGAGAAGAAAAAGAAGAAAAAGGACAAAGAGAAGAAAAAGAAA
GAG
GAGAAAAGCAAAGATAAGAAAGAAGAGGAGAAGAAAGAAGTTGTGGTTATTGATCCCTCGGGAAACA
CA
TATTACAACTGGCTGTTTTGCATCACATTACCTGTTATGTACAACTGGACAATGGTTATTGCCAGAGC
A
TGTTTTGATGAACTTCAATCTGATTACCTAGAATATTGGCTCATTTTGGATTACGTATCAGACATAGTC
TAT
TTAATCGATATGTTTGTACGAACAAGGACAGGTTACCTAGAACAAGGACTGCTGGTAAAGGAAGAAC
TT
AAACTCATAAATAAATATAAATCCAACTTGCAATTTAAACTTGATGTTCTGTCACTGATACCAACTGA
T
TTGCTGTATTTTAAGTTAGGGTGGAACTATCCAGAAATTAGATTAAACAGGTTGTTACGGTTCTCTCGT
ATG
TTTGAGTTCTTCCAGAGAACAGAAACAAGGACAAACTATCCAAACATCTTCAGGATTTCCAACCTTG
TT
ATGTATATCGTCATCATTATCCACTGGAATGCATGTGTGTTCTACTCTATTTCTAAAGCTATTGGATT
T
GGAAATGATACATGGGTCTACCCTGATATTAATGATCCTGAATTTGGCCGTTTGGCTAGAAAATACGTA
TAC
AGCCTTTACTGGTCTACACTGACTTTGACTACCATTGGTGAAACACCCCCTCCCGTGAGGGATTCTG
AG
TATGTCTTTGTGGTGGTTGATTTCCTAATTGGAGTGTTAATTTTTGCTACCATCGTTGGTAACATAGG
T
TCTATGATTTCCAACATGAATGCAGCCAGAGCAGAATTTCAAGCAAGAATTGATGCTATCAAGCAATAT
ATG
CATTTTCGAAATGTAAGCAAAGATATGGAAAAGAGGGTTATTAAATGGTTTGACTACCTGTGGACCA
AC
AAAAAAACAGTTGATGAGAAAGAAGTCTTAAAGTATCTACCTGATAAACTAAGAGCAGAAATTGCCAT
C
AACGTTCACTTAGACACATTAAAAAAGGTACGCATTTTTGCTGATTGTGAAGCTGGTCTGTTGGTGGAG
TTG
GTCTTGAAATTGCAACCCCAAGTCTACAGTCCTGGAGATTATATTTGCAAGAAAGGGGATATCGGAC
GA
GAGATGTACATTATCAAGGAAGGCAAACTCGCTGTGGTGGCAGATGATGGAGTCACTCAGTTTGTGGT
A
TTGAGCGATGGCAGCTACTTCGGTGAGATCAGCATTCTTAACATTAAAGGGAGCAAAGCTGGCAATCGA
AGA
ACGGCCAATATTAAAAGTATTGGCTACTCAGACCTGTTCTGTCTCTCAAAAGATGACCTCATGGAAG
CT
CTAACTGAGTACCCAGATGCCAAAACTATGCTGGAAGAGAAAGGGAAGCAGATTTTAATGAAAGATGG
T
CTACTGGATCTAAACATTGCAAATGCTGGCAGTGATCCTAAAGATCTTGAAGAGAAGGTTACTCGAATG
GAG
GGGTCAGTAGACCTCCTGCAAACCAGGTTTGCCCGAATCTTGGCTGAGTATGAGTCCATGCAGCAGA
AA
CTGAAACAAAGATTAACCAAGGTTGAGAAATTTCTGAAACCGCTTATTGACACAGAATTTTCAAGTAT
T
GAGGGACCTGGAGCGGAAAGTGGGCCCATCGACTCTACATAG


Translation (690 aa):
MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKS
L
RKGGPSQ
REQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKK
E
EKSKDKKE
EEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIV
Y
LIDMFVRTRT
GYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSR
M
FEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYV
Y
SLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY
M
HFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVE
L
VLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNR
R
TANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIANAGSDPKDLEEKVTRM
E
GSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSSIEGPGAESGPIDST




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser