NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS352.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
352.1 Public Homo sapiens 1 KPNA6 22 109 92 CCDS HistoryNCBI Gene:23633Re-query CCDS DB by CCDS ID:352.1Re-query CCDS DB by GeneID:23633See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 352.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000373625.7 ENSP00000362728.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373625.7Link to Ensembl Protein Viewer:ENSP00000362728.3Re-query CCDS DB by Nucleotide ID:ENST00000373625Re-query CCDS DB by Protein ID:ENSP00000362728
Original member Current member NCBI NM_012316.4 NP_036448.1 Accepted alive Link to Nucleotide Sequence:NM_012316.4Link to Protein Sequence:NP_036448.1Re-query CCDS DB by Nucleotide ID:NM_012316Re-query CCDS DB by Protein ID:NP_036448Link to BLAST:NP_036448.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036448.1 536 O60684 536 100% 0 0

Chromosomal Locations for CCDS 352.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 32108131 32108134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32154588 32154721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32156853 32156945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32157346 32157445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32158267 32158361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32159400 32159531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32160615 32160703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32161947 32162046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32162361 32162524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32163235 32163313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32166105 32166230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32167169 32167296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32169882 32170060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 32170707 32170894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1611 nt):
ATGGAGACCATGGCGAGCCCAGGGAAAGACAATTATCGAATGAAGAGCTATAAGAACAATGCTCTAAACC
CT
GAAGAAATGAGACGAAGAAGAGAGGAAGAGGGCATTCAGCTCCGGAAGCAGAAGCGAGAGCAACAACT
T
TTTAAACGGAGAAATGTGGAGCTGATTAATGAAGAAGCTGCCATGTTCGATAGTCTTCTCATGGACTCT
TAT
GTGAGCTCTACCACTGGGGAGAGTGTGATCACAAGAGAGATGGTGGAGATGCTCTTTTCTGATGATT
CT
GACCTGCAGTTAGCAACCACACAGAAATTCCGGAAACTGCTCTCCAAAGAGCCTAGTCCTCCAATAGA
T
GAAGTTATCAACACTCCAAGAGTGGTGGATCGGTTCGTGGAGTTTCTGAAGAGGAATGAGAATTGTACA
TTA
CAGTTTGAAGCTGCCTGGGCTCTAACGAATATTGCCTCTGGAACCTCTCAGCAGACCAAAATTGTCA
TT
GAAGCAGGGGCTGTCCCCATTTTTATAGAGCTGCTTAATTCAGACTTTGAGGATGTTCAGGAACAGGC
A
GTCTGGGCACTGGGAAACATAGCTGGAGATAGCTCTGTTTGCCGAGATTACGTCTTGAACTGTTCCATC
CTT
AATCCTTTGTTAACACTCCTTACCAAGTCCACACGACTGACGATGACACGGAATGCAGTCTGGGCCC
TG
TCAAATCTCTGCCGAGGGAAAAACCCACCCCCAGAGTTTGCAAAGGTCTCTCCTTGTTTGCCTGTACT
G
TCTCGCCTACTCTTCAGCAGCGACTCGGACTTGCTGGCAGATGCTTGCTGGGCCCTTTCTTATCTGTCT
GAT
GGCCCCAATGAGAAGATCCAGGCAGTCATAGACTCCGGAGTCTGCCGGAGATTGGTAGAGCTGCTGA
T
G
CACAATGATTACAAAGTGGCTTCTCCTGCCCTGAGAGCCGTGGGTAACATCGTCACTGGGGATGACAT
C
CAGACCCAGGTCATTCTTAACTGTTCAGCCCTACCTTGCCTTCTCCACTTGTTGAGCAGTCCCAAGGAG
TCA
ATCCGGAAGGAAGCTTGCTGGACTATTTCAAATATTACTGCTGGCAACAGGGCTCAAATACAGGCTG
TT
ATAGATGCAAATATCTTCCCTGTGTTGATCGAAATCCTTCAGAAAGCAGAGTTTCGTACAAGGAAAGA
G
GCAGCCTGGGCCATCACCAATGCCACATCAGGAGGAACCCCTGAGCAGATCAGGTACCTGGTCTCACTG
GGC
TGCATCAAACCCCTATGTGACTTGCTGACTGTAATGGATTCGAAGATTGTGCAAGTGGCCCTCAATG
GA
CTGGAGAACATCCTGCGGCTTGGAGAGCAAGAGGGCAAGCGCAGTGGCTCAGGGGTCAATCCTTATTG
T
GGCCTCATAGAGGAAGCCTATGGCTTGGATAAAATTGAGTTTCTCCAGAGCCACGAGAACCAGGAGATC
TAC
CAGAAGGCCTTCGACCTCATTGAGCACTACTTTGGTGTAGAAGACGATGATAGCAGCCTGGCTCCCC
AA
GTCGATGAAACGCAACAGCAGTTCATCTTCCAGCAGCCTGAGGCCCCCATGGAGGGCTTCCAGCTATA
A


Translation (536 aa):
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDS
Y
VSSTTG
ESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCT
L
Q
FEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSI
L
NPLL
TLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLS
D
GPNEKIQAVIDSGVCRRLVELL
MHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE
S
IRKEACWTISNITAGNRAQIQ
AVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
G
CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAY
GLDKIEFLQSHENQEI
Y
QKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser