NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34901.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34901.1 Public Homo sapiens 8 PDE7A 22 109 92 CCDS HistoryNCBI Gene:5150Re-query CCDS DB by CCDS ID:34901.1Re-query CCDS DB by GeneID:5150See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34901.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000379419.8 ENSP00000368730.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379419.8Link to Ensembl Protein Viewer:ENSP00000368730.4Re-query CCDS DB by Nucleotide ID:ENST00000379419Re-query CCDS DB by Protein ID:ENSP00000368730
Original member NCBI NM_002603.3 NP_002594.1 Updated not alive Link to Nucleotide Sequence:NM_002603.3Link to Protein Sequence:NP_002594.1Re-query CCDS DB by Nucleotide ID:NM_002603Re-query CCDS DB by Protein ID:NP_002594
Current member NCBI NM_002603.4 NP_002594.1 Accepted alive Link to Nucleotide Sequence:NM_002603.4Link to Protein Sequence:NP_002594.1Re-query CCDS DB by Nucleotide ID:NM_002603Re-query CCDS DB by Protein ID:NP_002594Link to BLAST:NP_002594.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002594.1 456 Q13946-2 456 100% 0 0

Chromosomal Locations for CCDS 34901.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 65719290 65719495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65723541 65723621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65724255 65724351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65724777 65724921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65726875 65726966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65727170 65727301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65734794 65734894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65739502 65739597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65745407 65745470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65747652 65747803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65779720 65779803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65782783 65782843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 65788882 65788941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1371 nt):
ATGGGAATTACATTGATCTGGTGTCTGGCCTTGGTTCTTATCAAGTGGATCACCTCTAAGAGGCGTGGAG
CT
ATTTCCTATGACAGTTCTGATCAGACTGCATTATACATTCGTATGCTAGGAGATGTACGTGTAAGGAG
C
CGAGCAGGATTTGAATCAGAAAGAAGAGGTTCTCACCCATATATTGATTTTCGTATTTTCCACTCTCAA
TCT
GAAATTGAAGTGTCTGTCTCTGCAAGGAATATCAGAAGGCTACTAAGTTTCCAGCGATATCTTAGAT
CT
TCACGCTTTTTTCGTGGTACTGCGGTTTCAAATTCCCTAAACATTTTAGATGATGATTATAATGGACA
A
GCCAAGTGTATGCTGGAAAAAGTTGGAAATTGGAATTTTGATATCTTTCTATTTGATAGACTAACAAAT
G
GA
AATAGTCTAGTAAGCTTAACCTTTCATTTATTTAGTCTTCATGGATTAATTGAGTACTTCCATTTAG
AT
ATGATGAAACTTCGTAGATTTTTAGTTATGATTCAAGAAGATTACCACAGTCAAAATCCTTACCATAA
C
GCAGTCCACGCTGCGGATGTTACTCAGGCCATGCACTGTTACTTAAAGGAACCTAAGCTTGCCAATTCT
GTA
ACTCCTTGGGATATCTTGCTGAGCTTAATTGCAGCTGCCACTCATGATCTGGATCATCCAGGTGTTA
AT
CAACCTTTCCTTATTAAAACTAACCATTACTTGGCAACTTTATACAAGAATACCTCAGTACTGGAAAA
T
CACCACTGGAGATCTGCAGTGGGCTTATTGAGAGAATCAGGCTTATTCTCACATCTGCCATTAGAAAGC
AG
G
CAACAAATGGAGACACAGATAGGTGCTCTGATACTAGCCACAGACATCAGTCGCCAGAATGAGTATC
TG
TCTTTGTTTAGGTCCCATTTGGATAGAGGTGATTTATGCCTAGAAGACACCAGACACAGACATTTGGT
T
TTACAGATGGCTTTGAAATGTGCTGATATTTGTAACCCATGTCGGACGTGGGAATTAAGCAAGCAGTGG
AGT
GAAAAAGTAACGGAGGAATTCTTCCATCAAGGAGATATAGAAAAAAAATATCATTTGGGTGTGAGTC
CA
CTTTGCGATCGTCACACTGAATCTATTGCCAACATCCAGATTGGTTTTATGACTTACCTAGTGGAGCC
T
TTATTTACAGAATGGGCCAGGTTTTCCAATACAAGGCTATCCCAGACAATGCTTGGACACGTGGGGCTG
AAT
AAAGCCAGCTGGAAGGGACTGCAGAGAGAACAGTCGAGCAGTGAGGACACTGATGCTGCATTTGAGT
TG
AACTCACAGTTATTACCTCAGGAAAATCGGTTATCATAA


Translation (456 aa):
MGITLIWCLALVLIKWITSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQ
S
EIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDYNGQAK
CMLEKVGNWNFDIFLFDRLTN
G
NSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANS
V
TPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYK
NTSVLENHHWRSAVGLLRESGLFSHLPLES
R
QQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQW
S
EKVTEEFFHQ
GDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGL
N
KASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser