NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS34315.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34315.1 Public Homo sapiens 5 MAML1 22 109 92 CCDS HistoryNCBI Gene:9794Re-query CCDS DB by CCDS ID:34315.1Re-query CCDS DB by GeneID:9794See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34315.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000292599.3 ENSP00000292599.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000292599.3Link to Ensembl Protein Viewer:ENSP00000292599.3Re-query CCDS DB by Nucleotide ID:ENST00000292599Re-query CCDS DB by Protein ID:ENSP00000292599
Original member Current member NCBI NM_014757.4 NP_055572.1 Accepted alive Link to Nucleotide Sequence:NM_014757.4Link to Protein Sequence:NP_055572.1Re-query CCDS DB by Nucleotide ID:NM_014757Re-query CCDS DB by Protein ID:NP_055572Link to BLAST:NP_055572.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055572.1 1016 Q92585 1016 100% 0 0

Chromosomal Locations for CCDS 34315.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 179733113 179733427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179765326 179766741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179768850 179769089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179771147 179771243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179773895 179774877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3051 nt):
ATGGTGCTGCCCACCTGCCCCATGGCGGAGTTCGCGCTGCCGCGGCACAGCGCGGTCATGGAGCGCCTTC
GC
CGGCGCATCGAGCTGTGCCGGCGCCACCACAGCACCTGCGAGGCCCGCTACGAGGCCGTGTCGCCCGA
G
CGCCTGGAGCTGGAGCGCCAACACACCTTCGCCCTGCACCAGCGCTGCATCCAGGCCAAGGCCAAGCGC
GCC
GGGAAGCACAGGCAGCCGCCCGCCGCCACGGCCCCGGCGCCCGCCGCCCCGGCCCCGCGCCTGGACG
CC
GCTGACGGCCCCGAGCACGGCCGCCCGGCCACGCATCTTCATGATACAGTTAAGAGGAATCTTGACAG
C
GCCACTTCCCCTCAGAATGGCGATCAACAGAATGGCTACGGGGACCTCTTTCCTGGGCATAAGAAGACT
CGC
CGGGAGGCCCCTCTGGGAGTTGCCATCTCTTCCAATGGACTGCCTCCAGCCTCCCCCCTCGGTCAGT
CT
GACAAGCCTTCTGGAGCCGACGCCCTGCAGTCCAGTGGGAAGCACTCTCTGGGGCTAGACTCTCTCAA
C
AAAAAGCGTCTGGCTGACTCCAGCCTTCACTTGAATGGAGGCAGTAACCCCAGTGAGTCATTTCCTCTG
AGC
CTGAATAAAGAACTGAAGCAGGAGCCTGTCGAAGACCTGCCTTGCATGATCACTGGGACTGTCGGCT
CC
ATATCGCAAAGCAACCTCATGCCAGACCTCAACCTTAACGAGCAGGAGTGGAAGGAGCTCATCGAGGA
G
CTGAACAGGTCGGTGCCCGATGAAGACATGAAGGACCTGTTTAATGAGGACTTCGAGGAGAAGAAGGAC
CCA
GAGTCTTCTGGCTCTGCCACACAAACCCCCTTGGCACAGGACATTAATATTAAGACGGAATTCTCTC
CA
GCAGCCTTTGAGCAAGAACAGTTAGGCTCTCCACAAGTGAGGGCCGGGTCTGCAGGGCAGACCTTTCT
G
GGGCCTTCCTCTGCCCCTGTGAGTACAGATTCCCCCAGCCTAGGGGGCTCCCAAACCTTATTCCACACC
TCT
GGTCAGCCCCGGGCGGACAATCCCAGTCCAAACCTGATGCCGGCATCAGCCCAGGCCCAGAACGCAC
AA
AGAGCCCTTGCAGGTGTGGTATTGCCCAGTCAGGGCCCAGGAGGGGCCTCAGAGCTGTCCTCTGCCCA
C
CAGCTCCAGCAGATCGCTGCCAAGCAGAAGCGCGAGCAGATGCTCCAGAACCCACAGCAGGCCACCCCG
GCA
CCAGCCCCGGGCCAGATGTCCACATGGCAGCAGACGGGGCCCTCCCACAGTTCCTTAGATGTCCCTT
AC
CCCATGGAGAAGCCTGCCAGCCCTTCCAGCTACAAGCAAGACTTCACTAACTCCAAACTGCTCATGAT
G
CCTAGTGTGAATAAGAGTTCCCCTCGGCCCGGAGGCCCCTACCTCCAGCCCAGCCATGTGAACCTGCTG
AGT
CACCAGCCACCGAGTAACTTGAATCAGAACTCCGCGAATAACCAGGGGTCTGTGCTGGACTACGGCA
AT
ACAAAACCCCTTTCTCATTACAAAGCGGACTGTGGGCAAGGCAGCCCGGGGTCTGGCCAGAGCAAGCC
A
GCCCTGATGGCTTATCTTCCCCAGCAGCTGTCCCATATAAGTCACGAGCAGAACTCCCTGTTTCTGATG
AAG
CCAAAGCCAGGAAATATGCCTTTCCGATCACTGGTTCCACCTGGCCAGGAGCAGAACCCTTCCAGTG
TC
CCTGTGCAAGCCCAGGCTACCAGTGTTGGGACCCAGCCGCCTGCCGTGTCCGTGGCCAGCTCCCACAA
C
AGCTCCCCCTATCTCAGCAGCCAGCAACAGGCCGCTGTAATGAAGCAGCATCAGTTGCTTTTGGACCAA
CAG
AAACAAAGGGAGCAGCAGCAAAAGCATTTACAGCAACAGCAGTTCCTTCAGAGGCAACAGCACCTTC
TC
GCGGAACAGGAGAAGCAACAGTTTCAGCGCCATCTGACCCGCCCACCACCCCAGTACCAAGACCCGAC
A
CAAGGCAGCTTCCCACAGCAGGTTGGACAGTTCACAGGGTCCTCTGCTGCCGTGCCCGGCATGAACACC
TTG
GGTCCATCCAACTCCAGCTGTCCTCGAGTGTTCCCTCAGGCTGGGAATCTGATGCCAATGGGCCCTG
GA
CATGCTTCAGTTTCCTCTCTCCCCACAAACTCAGGCCAACAGGACCGGGGTGTGGCTCAGTTCCCTGG
C
TCCCAAAACATGCCTCAGAGCAGCCTCTATGGCATGGCTTCTGGCATAACCCAGATAGTTGCCCAGCCC
CCG
CCACAGGCCACCAATGGACATGCCCACATTCCACGGCAGACCAACGTGGGCCAGAACACCTCCGTCT
CA
GCTGCCTATGGGCAGAACTCTCTGGGAAGCTCTGGCCTCTCCCAGCAGCACAATAAGGGGACCCTGAA
C
CCTGGTTTAACAAAGCCACCGGTCCCAAGGGTGTCACCAGCCATGGGAGGCCAGAATTCCTCCTGGCAG
CAT
CAGGGAATGCCGAACCTCAGTGGCCAGACCCCAGGGAACAGCAACGTGAGTCCCTTCACTGCAGCCT
CC
AGTTTCCACATGCAGCAGCAGGCCCACCTGAAAATGTCTAGCCCGCAATTCTCCCAGGCAGTGCCCAA
C
AGGCCCATGGCTCCCATGAGCTCAGCAGCTGCCGTGGGGTCCTTGCTACCCCCAGTGAGTGCACAGCAG
AGG
ACCAGCGCCCCTGCCCCAGCACCACCCCCAACAGCCCCTCAGCAGGGCTTGCCTGGCCTGAGCCCAG
CA
GGGCCTGAGCTGGGGGCCTTCAGCCAGAGCCCTGCCTCACAGATGGGCGGTCGGGCGGGGCTGCACTG
C
ACCCAGGCCTACCCTGTGCGGACCGCGGGCCAGGAGCTGCCTTTTGCCTATAGCGGGCAGCCAGGTGGC
AGT
GGGCTCTCTAGTGTGGCTGGACACACCGATCTGATCGACTCCCTGCTGAAGAACAGGACTTCAGAGG
AG
TGGATGAGTGATTTGGACGACCTGTTAGGGTCTCAGTAA


Translation (1016 aa):
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKR
A
GKHRQPPAATAPAPAAPAPRLDAADGPEHGRPAT
HLHDTVKRNLDSATSPQNGDQQNGYGDLFPGHKKT
R
REAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHSLGLDSLNKKRLADSSLHLNGGSNPSESFPL
S
LNKELKQEPVEDLPCMITGTVGSISQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKD
P
ESSGSATQTPLAQDINIKTEFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHT
S
GQPRADNPSPNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP
A
PAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGPYLQPSHVNLL
S
HQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALMAYLPQQLSHISHEQNSLFLM
K
PKPGNMPFRSLVPPGQ
EQNPSSVPVQAQATSVGTQPPAVSVASSHNSSPYLSSQQQAAVMKQHQLLLDQ
Q
KQREQQQKHLQQQQFLQRQQHLLAEQ
EKQQFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNT
L
GPSNSSCPRVFPQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQP
P
PQATNGHAHIPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ
H
QGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVGSLLPPVSAQQ
R
TSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQAYPVRTAGQELPFAYSGQPGG
S
GLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser