NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS33055.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33055.1 Public Homo sapiens 19 MYPOP 22 109 92 CCDS HistoryNCBI Gene:339344Re-query CCDS DB by CCDS ID:33055.1Re-query CCDS DB by GeneID:339344See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33055.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000322217.5 ENSP00000325402.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000322217.5Link to Ensembl Protein Viewer:ENSP00000325402.4Re-query CCDS DB by Nucleotide ID:ENST00000322217Re-query CCDS DB by Protein ID:ENSP00000325402
Original member Current member NCBI NM_001012643.3 NP_001012661.1 Accepted alive Link to Nucleotide Sequence:NM_001012643.3Link to Protein Sequence:NP_001012661.1Re-query CCDS DB by Nucleotide ID:NM_001012643Re-query CCDS DB by Protein ID:NP_001012661Link to BLAST:NP_001012661.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001012661.1 399 Q86VE0 399 100% 0 0

Chromosomal Locations for CCDS 33055.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 45890623 45891323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 45901275 45901773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1200 nt):
ATGGCCTCGGCGGCGGCGGGCGAAGCGGAGGAAACCACCCGGTTGCGCAAGCCGCGCTTCTCATTCGAAG
AG
AACCAGATCCTGATCCGCGAGGTGCGCGCCCACTACCCGCAGCTCTACGGCGCGCAGAGCCGTCGGGT
G
AGCGTGGCAGAGCGGCGGCGCGTGTGGGACGGCATCGCCGCCAAGATCAACGGTATCACCAGCTGGAAG
CGC
ACGGGCCAGGAGGTGCAGAAGCGCTGGAACGACTTCAAGCGCCGCACCAAGGAGAAGCTCGCTCGCG
TG
CCGCACTCCACGCAGGGCGCCGGGCCCGCCGCGGAGGACGCTTTCTCCGCGGAAGAGGAGACCATTTT
T
GCCATCCTGGGGCCAGGTGTGGCGGCGCCGGGGGCAGGTGCTGGGGCGGAGGAGCCCCCTGCGGCCCCC
TCT
TCACAGCCGCCGCCCCCAAGCGCCTGCCCTCAGCGCTACGTGTTGTCGGAAGACCGCCGGGAGGACC
GA
CGTGCAGATACATCAGCCCACAGCAAGGCGGGCTCCAGCAGCCCGGAGCCATGGGCCCGGCCCTCCTG
C
ACTCCCCAGGAAGGGGGCTGCCCACGGCCCAAGGAGCGTGAGTCACCACCCCCTTCGGCCCTGCAGCCG
GTC
CAGCTGCCTCGCCTGGCCTTGTCTCCACCACCCCCAGCCCCTCCACTGCCACCCCCACCGCCACTGG
CC
CAAGTGGCACCCTCACCCCCTAGCCCCCCACCCCCTCCTCGGCCTCCACCCACGCTCTCGGCCTCAGA
C
CCCTCCCTGGACTTCCTGCGGGCCCAGCAGGAGACTGCCAACGCCATCCGGGAGCTGGCCGGCACCCTT
CGA
CAGGGACTGGCCAAACTGAGCGAGGCCCTCAGCGCTCTGCTGCCCCTTCTGCCAGGAACCCCAGTTG
AC
TCCCTGCCTCCACCTCTGCCCCCACCCCCACCCCCACCGCCACCTCCCAGGCCTGTCCTGCCCCCACC
G
GCCCCCAAGGTGGAGATCACCCCAGAGCCCGTGTCCGTGGTGGCTGCTGTGGTGGACGGGGCAGTGGTG
GCA
GCCAGGGGAGTGATCATTGCCCCAAGGAGCGAGGAGGGGGCACCCCGGCCCCCCCCAGCCCCGCTCC
CT
CCGCACGACTCCCCCCCACACAAGCGGAGAAAAGGTTTCCCTACACGGAAAAGGCGCGGCCGATGGAA
A
TCTCCGTGA


Translation (399 aa):
MASAAAGEAEETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGIAAKINGITSWK
R
TGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAILGPGVAAPGAGAGAEEPPAAP
S
SQPPPPSACPQRYVLSEDRREDRRA
DTSAHSKAGSSSPEPWARPSCTPQEGGCPRPKERESPPPSALQP
V
QLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPPTLSASDPSLDFLRAQQETANAIRELAGTL
R
QGLAKLSEALSALLPLLPGTPVDSLPPPLPPPPPPPPPPRPVLPPPAPKVEITPEPVSVVAAVVDGAVV
A
ARGVIIAPRSEEGAPRPPPAPLPPHDSPPHKRRKGFPTRKRRGRWKSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser