NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32031.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32031.1 Public Homo sapiens 14 OR4N5 22 109 92 CCDS HistoryNCBI Gene:390437Re-query CCDS DB by CCDS ID:32031.1Re-query CCDS DB by GeneID:390437See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 32031.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000333629.1 ENSP00000332110.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000333629.1Link to Ensembl Protein Viewer:ENSP00000332110.1Re-query CCDS DB by Nucleotide ID:ENST00000333629Re-query CCDS DB by Protein ID:ENSP00000332110
Original member Current member EBI,WTSI ENST00000641086.1 ENSP00000493307.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641086.1Link to Ensembl Protein Viewer:ENSP00000493307.1Re-query CCDS DB by Nucleotide ID:ENST00000641086Re-query CCDS DB by Protein ID:ENSP00000493307
Original member Current member NCBI NM_001004724.1 NP_001004724.1 Accepted alive Link to Nucleotide Sequence:NM_001004724.1Link to Protein Sequence:NP_001004724.1Re-query CCDS DB by Nucleotide ID:NM_001004724Re-query CCDS DB by Protein ID:NP_001004724Link to BLAST:NP_001004724.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001004724.1 308 Q8IXE1 308 100% 0 0

Chromosomal Locations for CCDS 32031.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 20143736 20144662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (927 nt):
ATGGAAACACAGAACCTCACAGTGGTGACAGAATTCATTCTTCTTGGTCTGACCCAGTCTCAAGATGCTC
AA
CTTCTGGTCTTTGTGCTAGTCTTAATTTTCTACCTTATCATCCTCCCTGGAAATTTCCTCATCATTTT
C
ACCATAAAGTCAGACCCTGGGCTCACAGCCCCCCTCTATTTCTTTCTGGGCAACTTGGCCTTACTGGAT
GCA
TCCTACTCCTTCATTGTGGTTCCCAGGATGTTGGTGGACTTCCTCTCTGAGAAGAAGGTAATCTCCT
AT
AGAAGCTGCATCACTCAGCTCTTTTTCTTGCATTTTCTTGGAGCGGGAGAGATGTTCCTCCTCGTTGT
G
ATGGCCTTTGACCGCTACATCGCCATCTGCCGGCCTTTACACTATTCAACCATCATGAACCCTAGAGCC
TGC
TATGCATTATCGTTGGTTCTGTGGCTTGGGGGCTTTATCCATTCCATTGTACAAGTAGCCCTTATCC
TG
CACTTGCCTTTCTGTGGCCCAAACCAGCTCGATAACTTCTTCTGTGATGTTCCACAGGTCATCAAGCT
G
GCCTGCACCAATACCTTTGTGGTGGAGCTTCTGATGGTCTCCAACAGTGGCCTGCTCAGCCTCCTGTGC
TTC
CTGGGCCTTCTGGCCTCCTATGCAGTCATCCTCTGTCGTATAAGGGAGCACTCCTCTGAAGGAAAGA
GC
AAGGCTATTTCCACATGCACCACCCATATTATCATTATATTTCTCATGTTTGGACCTGCTATTTTCAT
C
TACACTTGCCCCTTCCAGGCTTTCCCAGCTGACAAGGTAGTTTCTCTTTTCCATACTGTCATCTTTCCT
TTG
ATGAACCCTGTTATTTATACGCTTCGCAACCAGGAGGTGAAAGCTTCCATGAGGAAGTTGTTAAGTC
AA
CATATGTTTTGCTGA


Translation (308 aa):
METQNLTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIIFTIKSDPGLTAPLYFFLGNLALLD
A
SYSFIVVPRMLVDFLSEKKVISYRSCITQLFFLHFLGAGEMFLLVVMAFDRYIAICRPLHYSTIMNPRA
C
YALSLVLWLGGFIHSIVQVALILHLPFCGPNQLDNFFCDVPQVIKLACTNTFVVELLMVSNSGLLSLLC
F
LGLLASYAVILCRIREHSSEGKSKAISTCTTHIIIIFLMFGPAIFIYTCPFQAFPADKVVSLFHTVIFP
L
MNPVIYTLRNQEVKASMRKLLSQHMFC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser