NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS31884.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31884.1 Public Homo sapiens 12 ANO4 22 109 92 CCDS HistoryNCBI Gene:121601Re-query CCDS DB by CCDS ID:31884.1Re-query CCDS DB by GeneID:121601See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 31884.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000392979.7 ENSP00000376705.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392979.7Link to Ensembl Protein Viewer:ENSP00000376705.3Re-query CCDS DB by Nucleotide ID:ENST00000392979Re-query CCDS DB by Protein ID:ENSP00000376705
Original member Current member NCBI NM_178826.3 NP_849148.2 Accepted alive Link to Nucleotide Sequence:NM_178826.3Link to Protein Sequence:NP_849148.2Re-query CCDS DB by Nucleotide ID:NM_178826Re-query CCDS DB by Protein ID:NP_849148Link to BLAST:NP_849148.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_849148.2 920 Q32M45-2 920 100% 0 0

Chromosomal Locations for CCDS 31884.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 100901786 100901840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 100939315 100939451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 100942377 100942535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 100971306 100971406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 100974845 100974889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 100987539 100987670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101020034 101020140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101037095 101037150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101039955 101040076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101042334 101042468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101043539 101043635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101048341 101048401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101079193 101079275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101083678 101083818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101086660 101086824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101094256 101094292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101096536 101096647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101097651 101097708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101097848 101097945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101099578 101099720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101110404 101110556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101111563 101111710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101116679 101116798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101120520 101120625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101126879 101127070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2763 nt):
ATGGAGGCAAGCTCTTCTGGAATCACTAATGGAAAAACCAAAGTCTTCCACCCAGTGGCCAAGGATGTCA
AT
ATTCTTTTTGATGAATTAGAAGCTGTCAGCAGTCCTTGCAAAGATGACGATTCTCTTCTTCACCCTGG
A
AACCTGACTAGTACTTCAGATGATGCCAGCAGATTGGAAGCCGGGGGAGAGACAGTGCCAGAAAGAAAC
AAA
TCAAATGGACTTTACTTTCGAGATGGAAAGTGTCGAATTGACTACATCCTTGTGTACAGAAAATCCA
AC
CCCCAGACTGAAAAGAGAGAAGTATTTGAAAGAAACATTAGAGCAGAAGGATTGCAAATGGAGAAAGA
G
TCCTCTCTAATAAATAGTGACATTATCTTTGTGAAGTTGCATGCCCCATGGGAAGTCCTTGGAAGATAT
GCA
GAACAAATGAATGTAAGAATGCCTTTCAGGAGAAAAATCTATTACCTGCCCCGCCGTTACAAGTTCA
TG
AGCAGGATCGATAAACAAATAAGCAGGTTTCGGAGATGGTTACCTAAGAAGCCAATGAGGCTGGACAA
G
GAGACACTGCCAGACCTGGAGGAGAATGACTGCTACACTGCCCCTTTCAGCCAGCAAAGGATCCATCAC
TTC
ATCATACACAACAAAGAAACGTTCTTCAACAATGCCACAAGAAGTAGAATCGTGCATCACATTTTAC
AA
AGAATAAAATATGAAGAAGGAAAAAACAAGATTGGTCTGAATCGTTTGCTTACCAATGGCTCCTATGA
A
GCTGCGTTTCCCCTGCATGAGGGAAGTTATAGAAGTAAAAACTCCATTCGAACCCATGGAGCAGAAAAC
CAC
CGACATCTACTCTATGAGTGCTGGGCCTCCTGGGGCGTGTGGTATAAATACCAACCTTTGGATCTTG
TA
AGGCGGTACTTTGGAGAGAAGATTGGGTTATATTTTGCCTGGTTGGGCTGGTACACCGGCATGCTCTT
C
CCAGCTGCCTTCATTGGATTGTTTGTCTTTTTGTATGGCGTCACCACTCTGGATCACAGCCAAGTCAGT
AAA
GAAGTCTGCCAAGCTACAGATATCATCATGTGTCCTGTGTGTGATAAATACTGTCCATTCATGAGGC
TG
TCAGACAGCTGTGTATATGCCAAGGTAACCCACCTTTTTGACAATGGAGCCACTGTCTTCTTTGCTGT
T
TTCATGGCAGTCTGGGCAACAGTTTTCCTGGAGTTTTGGAAAAGACGGCGAGCAGTAATTGCTTATGAC
TGG
GATTTGATAGACTGGGAAGAAGAGGAGGAAGAAATACGACCCCAGTTTGAAGCCAAGTATTCCAAGA
AA
GAGCGGATGAATCCAATTTCTGGAAAGCCAGAACCTTATCAAGCATTTACAGATAAATGCAGCAGACT
T
ATCGTTTCTGCATCTGGAATATTTTTTATGATCTGCGTGGTGATTGCTGCCGTGTTCGGGATCGTCATT
TAC
CGGGTGGTGACTGTCAGCACTTTCGCTGCCTTTAAGTGGGCGTTAATCAGGAATAACTCTCAGGTTG
CA
ACCACAGGGACTGCTGTGTGCATCAACTTCTGTATCATTATGTTGCTGAATGTGCTCTATGAAAAAGT
T
GCCCTGCTTCTGACGAATTTAGAACAGCCTCGCACAGAGTCTGAGTGGGAGAACAGCTTCACCCTGAAA
ATG
TTTCTTTTTCAGTTTGTCAATCTGAACAGCTCCACATTTTACATCGCATTCTTCCTCGGAAGATTTA
CA
GGACACCCAGGTGCCTACTTGAGGCTGATAAACAGGTGGAGACTAGAAGAGTGCCACCCTAGTGGATG
C
CTTATTGATCTGTGTATGCAAATGGGTATTATAATGGTGCTAAAGCAGACCTGGAATAATTTCATGGAA
CTT
GGCTACCCGTTAATTCAGAATTGGTGGACTAGAAGAAAAGTACGACAAGAACATGGACCTGAAAGGA
AA
ATAAGTTTCCCACAATGGGAAAAGGACTATAACCTTCAGCCGATGAATGCCTATGGACTCTTCGATGA
A
TACTTAGAAATGATTCTTCAGTTTGGATTCACAACTATCTTTGTGGCAGCTTTTCCCCTAGCACCACTT
CTG
GCCTTACTGAATAACATAATTGAAATTCGACTTGATGCTTACAAATTTGTCACACAGTGGAGGAGAC
CT
TTAGCTTCAAGGGCCAAAGACATAGGAATTTGGTATGGAATTCTTGAAGGCATTGGAATTCTCTCTGT
T
ATCACAAATGCATTTGTCATAGCGATAACATCTGACTTTATCCCTCGCTTGGTGTATGCTTATAAGTAT
GGA
CCTTGTGCAGGCCAAGGAGAAGCTGGGCAAAAGTGCATGGTTGGCTATGTGAATGCCAGCTTGTCTG
TA
TTTCGAATTTCTGACTTTGAGAACCGATCTGAGCCTGAATCTGATGGCAGTGAGTTCTCGGGGACTCC
T
CTTAAGTACTGCAGATACCGGGACTACCGTGACCCGCCTCATTCACTGGTGCCCTATGGCTACACACTG
CAG
TTTTGGCATGTCCTAGCTGCTCGATTAGCTTTTATCATTGTCTTTGAGCACCTCGTGTTTTGTATAA
AG
CACCTCATTTCATATCTGATCCCAGACCTCCCAAAAGACCTAAGGGATCGAATGAGAAGAGAGAAGTA
C
TTGATTCAGGAGATGATGTATGAAGCAGAACTGGAACGTCTCCAGAAGGAACGAAAGGAGAGGAAGAAG
AAT
GGAAAAGCACACCACAACGAGTGGCCGTGA


Translation (920 aa):
MEASSSGITNGKTKVFHPVAKDVNILFDELEAVSSPCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERN
K
SNGLYFRDGKCRIDYILVYRKSNPQTEKREVFERNIRAEGLQMEKE
SSLINSDIIFVKLHAPWEVLGRY
A
EQMNVRMPF
RRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHH
F
IIHNKETFFNNATRSRIVHHILQRIKYEEGKNKI
GLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAEN
H
RHLLYECWASWGVWYKYQPLDLV
RRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVS
K
EVCQATDIIMCPVCDKYCPFMRLSDSCVYAK
VTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYD
W
DLIDWEEEE
EEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVI
Y
RVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNV
LYEKVALLLTNLEQPRTESEWENSFTLK
M
FLFQFVNLNSSTFYIAFFLG
RFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFME
L
GY
PLIQNWWTRRKVRQEHGPERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPL
L
ALLNNIIEIRLDAYKFVTQWRRPLASRAKDI
GIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKY
G
PCAGQGEAGQ
KCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTL
Q
FWHVLAARLAFIIVFE
HLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKERKK
N
GKAHHNEWP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser