NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS30877.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30877.1 Public Homo sapiens 1 SHE 22 109 92 CCDS HistoryNCBI Gene:126669Re-query CCDS DB by CCDS ID:30877.1Re-query CCDS DB by GeneID:126669See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30877.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000304760.2 ENSP00000307369.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000304760.2Link to Ensembl Protein Viewer:ENSP00000307369.2Re-query CCDS DB by Nucleotide ID:ENST00000304760Re-query CCDS DB by Protein ID:ENSP00000307369
Original member Current member NCBI NM_001010846.2 NP_001010846.1 Accepted alive Link to Nucleotide Sequence:NM_001010846.2Link to Protein Sequence:NP_001010846.1Re-query CCDS DB by Nucleotide ID:NM_001010846Re-query CCDS DB by Protein ID:NP_001010846Link to BLAST:NP_001010846.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001010846.1 495 Q5VZ18 495 100% 0 0

Chromosomal Locations for CCDS 30877.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 154484149 154484335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154485943 154486062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154486527 154486683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154489051 154489356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154499112 154499238 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154501436 154502026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGCAGTGGTCCCCGACCCCTGGCGCCTCTGCGTGTCTGGGCTGGGCTTCCTCGCTCGCCTGCTCCACGG
CC
CCGACGCTCCTGGGCCGAGCCGGCCGGGGCCCCCTCATGGCGGCCAAGTGGTTCAAGGAGTTCCCCCT
G
AACCTGAAGACCGTGTCGGAGCGGGCCAAGCCCGGGGGCGGCGGCGGCAAATTGCGCAAGAACTCGGAG
GCG
GGCGGCGCTGGGCCGGGTCCTGGCAAGGGCCGCAAGAACTCGGCGGCCGAGCTGGGGAGCGGCAGGG
CC
GGCGTCGGCCCCAAGGACAGCCGGCTGTCCCGCGACAGCCTGCAGGGTCTGATTCAGGCCGCCGCGGG
C
AAGGGCCGCAAAAACTCCCGGGCCACGGAGGAGGAGCCCCACCGGGGTGCAACCAAGAGCTCGGGCTGC
AGC
ACCTACATCAACAGGCTCATCAAGGTGGACACTCAGGAGAAGAACGGGAAGAGCAACTACCCCAGCA
GC
AGTAGCTCCAGCTCCAGCTCCTCTTCCTCCGCGTCCTCTTCCCCTTCCTCCCTGGGGCCCGAGCTGGA
C
AAGGGCAAGATTATTAAGCAGCAAGAGACGGTCATCATTTTAGAAGACTATGCTGACCCTTATGATGCC
AAA
CGGACAAAGGGTCAAAGGGATGCAGAGAGAGTCGGAGAGAACGACGGTTACATGGAACCATATGATG
CA
CAGCAAATGATAACAGAAATTAGACGACGGGGTTCCAAAGATCCCCTGGTGAAGGCTCTCCAGCTGCT
T
GACAGTCCCTGTGAACCCGCAGACGGTGGCCTGAAATCAGAGACCTTGGCCAAAAGACGGAGTTCCAAG
GAC
CTCCTGGGGAAGCCGCCACAGCTATACGACACTCCCTACGAGCCTGCAGAAGGGGGGCCCAGGGCAG
AG
GGGAAGGCGCGGCCCCCAGACAGCCGGCTGCCCGAGAACGACGAGAGGCCCGCGGCAGAGTACGAGCA
G
CCATGGGAGTGGAAGAAGGAGCAGATCGTGCGGGCTCTGTCAGTCCAGTTTGAAGGAGCTGAGCGACCT
TCC
TTCAGGGAGGAGACAGTGAGGCAGCACCACCGGCAGAAGAGCTGGACCCAGAAGATCCTGAAGCCAG
CC
CTCTCGGACCACAGTGAGGGAGAGAAAGTGGACCCGGGCCTGCCCCTGGAGAAGCAGCCCTGGTATCA
T
GGTGCCATCAGCCGTGCTGAGGCTGAGAGTCGACTACAGCCCTGCAAAGAAGCTGGTTACCTGGTTCGA
AAT
AGTGAGTCAGGGAACAGCAGGTACTCCATTGCCCTAAAGACTAGTCAAGGATGTGTCCACATCATAG
TG
GCTCAGACCAAAGACAACAAATACACACTGAATCAGACAAGCGCTGTGTTTGACAGCATCCCTGAAGT
G
GTACACTATTATTCCAATGAAAAGTTGCCTTTCAAAGGGGCAGAACACATGACTTTACTCTACCCAGTG
CAC
AGCAAGCTTCACTAA


Translation (495 aa):
MQWSPTPGASACLGWASSLACSTAPTLLGRAGRGPLMAAKWFKEFPLNLKTVSERAKPGGGGGKLRKNSE
A
GGAGPGPGKGRKNSAAELGSGRAGVGPKDSRLSRDSLQGLIQAAAGKGRKNSRATEEEPHRGATKSSGC
S
TYINRLIKVDTQEKNGKSNYPSSSSSSSSSSSSASSSPSSLGPELDKGKIIKQQET
VIILEDYADPYDA
K
RTKGQRDAERVGENDGYMEPYDAQQMIT
EIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSK
D
LLGKPPQLYDTPYEPAEGGPRAEGKARPPDSRLPENDERPAAEYEQPWEWKKEQIVRALS
VQFEGAERP
S
FREETVRQHHRQKSWTQKILKPALSDHSEGEKVDPGLPLEKQ
PWYHGAISRAEAESRLQPCKEAGYLVR
N
SESGNSRYSIAL
KTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNEKLPFKGAEHMTLLYPV
H
SKLH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser