NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2993.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2993.1 Public Homo sapiens 3 COX17 22 109 92 CCDS HistoryNCBI Gene:10063Re-query CCDS DB by CCDS ID:2993.1Re-query CCDS DB by GeneID:10063See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2993.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000261070.6 ENSP00000261070.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261070.6Link to Ensembl Protein Viewer:ENSP00000261070.2Re-query CCDS DB by Nucleotide ID:ENST00000261070Re-query CCDS DB by Protein ID:ENSP00000261070
Original member Current member EBI,WTSI ENST00000468918.5 ENSP00000417805.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000468918.5Link to Ensembl Protein Viewer:ENSP00000417805.1Re-query CCDS DB by Nucleotide ID:ENST00000468918Re-query CCDS DB by Protein ID:ENSP00000417805
Original member Current member EBI,WTSI ENST00000497116.1 ENSP00000417923.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000497116.1Link to Ensembl Protein Viewer:ENSP00000417923.1Re-query CCDS DB by Nucleotide ID:ENST00000497116Re-query CCDS DB by Protein ID:ENSP00000417923
Original member Current member NCBI NM_005694.1 NP_005685.1 Accepted alive Link to Nucleotide Sequence:NM_005694.1Link to Protein Sequence:NP_005685.1Re-query CCDS DB by Nucleotide ID:NM_005694Re-query CCDS DB by Protein ID:NP_005685Link to BLAST:NP_005685.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005685.1 63 Q14061 63 100% 0 0

Chromosomal Locations for CCDS 2993.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 119675149 119675233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 119677204 119677310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (192 nt):
ATGCCGGGTCTGGTTGACTCAAACCCTGCCCCGCCTGAGTCTCAGGAGAAGAAGCCGCTGAAGCCCTGCT
GC
GCTTGCCCGGAGACCAAGAAGGCGCGCGATGCGTGTATCATCGAGAAAGGAGAAGAACACTGTGGACA
T
CTAATTGAGGCCCACAAGGAATGCATGAGAGCCCTAGGATTTAAAATATGA


Translation (63 aa):
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser