NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29125.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29125.1 Public Mus musculus 18 Apc 21 106 86 CCDS HistoryNCBI Gene:11789Re-query CCDS DB by CCDS ID:29125.1Re-query CCDS DB by GeneID:11789See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29125.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000079362 ENSMUSP00000078337 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079362Link to Ensembl Protein Viewer:ENSMUSP00000078337Re-query CCDS DB by Nucleotide ID:ENSMUST00000079362Re-query CCDS DB by Protein ID:ENSMUSP00000078337
Original member Current member EBI,WTSI OTTMUST00000092329 OTTMUSP00000051004 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000092329Link to Vega Protein Viewer:OTTMUSP00000051004Re-query CCDS DB by Nucleotide ID:OTTMUST00000092329Re-query CCDS DB by Protein ID:OTTMUSP00000051004
Original member Current member NCBI NM_007462.3 NP_031488.2 Accepted alive Link to Nucleotide Sequence:NM_007462.3Link to Protein Sequence:NP_031488.2Re-query CCDS DB by Nucleotide ID:NM_007462Re-query CCDS DB by Protein ID:NP_031488Link to BLink:NP_031488.2

Chromosomal Locations for CCDS 29125.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 34261023 34261157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34268298 34268379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34269056 34269254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34272439 34272547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34276564 34276677 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34279269 34279352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34289838 34289942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34296031 34296129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34298423 34298801 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34299966 34300061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34304583 34304722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34305566 34305643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34306263 34306379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34310693 34310907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34312005 34318581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8529 nt):
ATGGCTGCAGCTTCATATGATCAGTTGTTAAAGCAAGTTGAGGCACTGAAGATGGAGAACTCAAATCTTC
GA
CAAGAGCTAGAAGATAATTCCAATCATCTTACAAAACTGGAAACTGAGGCATCTAATATGAAGGAAGT
A
CTTAAGCAGCTACAGGGAAGTATTGAAGATGAGACTATGACTTCTGGACAGATTGACTTACTAGAGCGT
CTT
AAAGAATTTAACTTAGATAGTAATTTCCCCGGAGTGAAACTACGCTCAAAAATGTCCCTTCGCTCCT
AC
GGAAGTCGGGAAGGATCTGTATCCAGCCGTTCAGGAGAATGCAGTCCTGTCCCCATGGGGTCATTCCC
A
AGAAGAACATTTGTAAATGGAAGCAGAGAGAGTACTGGGTATCTAGAAGAGCTTGAAAAAGAAAGATCA
TTA
CTCCTTGCTGATCTTGACAAAGAAGAGAAGGAAAAGGACTGGTATTATGCTCAACTTCAGAACCTCA
CA
AAAAGAATAGATAGCCTGCCTTTAACTGAAAATTTTTCCTTACAGACAGACATGACAAGACGGCAGCT
G
GAGTATGAAGCAAGGCAGATCAGGGCTGCAATGGAGGAGCAGCTTGGCACCTGCCAGGACATGGAGAAG
CGT
GCACAGCGAAGAATAGCCAGGATCCAGCAAATAGAAAAGGACATACTGCGCGTGCGCCAGCTTTTAC
AG
TCCCAGGCGGCGGAAGCGGAGAGGTCATCTCAGAGCAGGCATGATGCTGCCTCCCATGAAGCTGGCCG
G
CAGCACGAAGGCCACGGAGTGGCAGAAAGCAACACCGCAGCCTCCAGTAGTGGTCAGAGTCCAGCTACA
CGT
GTGGATCACGAAACAGCCAGTGTTTTGAGTTCTAGCGGCACGCACTCTGCTCCTCGAAGGTTGACAA
GT
CATCTGGGGACAAAGGTGGAAATGGTGTATTCCTTGTTGTCAATGCTTGGTACTCATGATAAGGACGA
T
ATGTCACGAACTTTGCTAGCTATGTCCAGCTCCCAAGACAGCTGTATATCCATGCGGCAGTCTGGATGT
CTT
CCTCTCCTCATCCAGCTTTTACATGGCAATGACAAAGACTCTGTATTGTTGGGAAATTCCCGGGGCA
GT
AAAGAGGCTCGGGCCAGGGCCAGTGCAGCACTCCACAACATCATTCACTCACAGCCTGATGACAAGAG
A
GGCAGGCGTGAAATCCGAGTCCTTCATCTTTTGGAACAGATACGAGCTTACTGTGAAACCTGTTGGGAG
TGG
CAGGAAGCCCACGAACAAGGCATGGACCAGGACAAAAACCCAATGCCAGCTCCTGTTGAGCATCAGA
TC
TGTCCTGCTGTGTGTGTTCTAATGAAGCTTTCATTTGATGAAGAGCATAGGCATGCAATGAATGAACT
T
GGGGGACTGCAGGCCATTGCAGAGTTATTGCAGGTGGACTGTGAGATGTATGGGCTTACTAATGACCAC
TAC
AGTGTTACTTTAAGACGGTATGCTGGAATGGCTTTGACAAACTTGACCTTTGGAGATGTTGCCAACA
AG
GCTACGCTGTGTTCTATGAAAGGCTGCATGAGAGCACTTGTGGCCCAGTTAAAATCTGAGAGTGAAGA
C
TTACAGCAGGTTATTGCAAGTGTTTTGAGGAATTTGTCTTGGCGAGCAGATGTAAATAGCAAAAAGACG
TTG
AGAGAAGTTGGAAGTGTGAAAGCATTGATGGAATGTGCTTTGGAAGTTAAAAAGGAATCAACCCTCA
AA
AGCGTTTTGAGTGCCTTATGGAACCTGTCTGCACACTGCACTGAGAATAAGGCTGACATCTGTGCTGT
G
GATGGAGCACTGGCATTTCTGGTTGGCACCCTCACTTACCGGAGCCAGACAAATACTTTAGCCATTATT
GAA
AGTGGAGGTGGGATATTACGGAATGTGTCCAGCTTGATAGCTACAAACGAAGACCACAGGCAAATCC
TA
AGAGAGAACAATTGCCTACAAACTTTATTACAGCACTTGAAATCTCACAGCTTGACAATAGTCAGTAA
T
GCATGTGGAACTTTGTGGAATCTCTCAGCAAGAAATCCTAAAGACCAGGAAGCCTTGTGGGACATGGGG
GCA
GTGAGCATGCTCAAGAACCTCATTCATTCCAAGCACAAAATGATTGCCATGGGAAGTGCAGCAGCTT
TA
AGGAATCTCATGGCAAACAGACCTGCAAAGTATAAGGATGCCAATATCATGTCTCCCGGCTCAAGTCT
G
CCATCCCTTCACGTTAGGAAACAGAAAGCTCTAGAAGCTGAGCTAGATGCTCAGCATTTATCAGAAACC
TTC
GACAACATTGACAACCTAAGTCCCAAGGCCTCTCACCGGAGTAAGCAGAGACACAAGCAGAATCTTT
AT
GGTGACTATGCTTTTGACGCCAATCGACATGATGATAGTAGGTCAGACAATTTCAATACTGGAAACAT
G
ACTGTTCTTTCACCATATTTAAATACTACGGTATTGCCCAGCTCTTCTTCCTCAAGGGGAAGTTTAGAC
AGT
TCTCGTTCTGAGAAAGACAGAAGTTTGGAGAGAGAGCGAGGTATTGGCCTCAGTGCTTACCATCCAA
CA
ACAGAAAATGCAGGAACCTCATCAAAACGAGGTCTGCAGATCACTACCACTGCAGCCCAGATAGCCAA
A
GTTATGGAAGAAGTATCAGCCATTCATACCTCCCAGGACGACAGAAGTTCTGCTTCTACCACCGAGTTC
CAT
TGTGTGGCAGACGACAGGAGTGCGGCACGAAGAAGCTCTGCCTCCCACACACACTCAAACACATACA
AC
TTCACTAAGTCGGAAAATTCAAATAGGACATGCTCTATGCCTTATGCCAAAGTGGAATATAAACGATC
T
TCAAATGACAGTTTAAATAGTGTCACTAGTAGTGATGGATATGGTAAAAGAGGCCAAATGAAACCCTCA
GTT
GAATCCTATTCTGAAGATGATGAAAGTAAATTTTGCAGTTATGGTCAGTATCCAGCTGACCTAGCCC
AT
AAGATACACAGTGCAAATCATATGGATGATAATGATGGAGAACTGGATACACCAATAAATTACAGTCT
T
AAATATTCAGATGAGCAGTTGAACTCAGGAAGGCAGAGTCCCTCACAGAATGAAAGGTGGGCAAGACCA
AAG
CATGTGATAGAAGATGAAATAAAGCAAAACGAGCAAAGACAAGCAAGAAGCCAGAACACCAGTTATC
CT
GTCTATTCTGAGAATACCGATGACAAACACCTCAAATTCCAACCACATTTTGGACAACAAGAATGTGT
T
TCCCCATATAGGTCAAGGGGAACCAGTGGTTCAGAAACAAATCGAATGGGTTCTAGTCATGCAATTAAT
CAA
AATGTAAACCAGTCTCTGTGTCAGGAAGATGATTATGAAGATGATAAACCTACCAACTACAGTGAAC
GT
TATTCTGAGGAAGAACAACATGAAGAAGAAGAAGAGAGACCGACAAATTATAGCATAAAATATAATGA
A
GAGAAACATCATGTGGATCAGCCTATTGATTATAGTTTAAAATATGCCACTGACATTTCTTCCTCACAA
AAA
CCATCATTTTCATTCTCAAAGAATTCATCAGCACAAAGCACTAAACCTGAACATCTCTCTCCAAGCA
GC
GAGAATACAGCTGTACCTCCATCTAATGCCAAAAGGCAGAATCAGCTGCGTCCAAGTTCAGCACAAAG
A
AATGGCCAGACTCAAAAAGGCACTACTTGCAAAGTCCCCTCCATCAACCAAGAAACAATACAGACTTAC
TGC
GTAGAAGACACCCCAATATGTTTTTCAAGGTGCAGTTCATTATCATCACTGTCATCAGCTGACGATG
AA
ATAGGATGTGATCAGACAACACAGGAAGCAGATTCTGCTAATACTCTGCAGACAGCAGAAGTAAAAGA
G
AATGATGTAACTCGGTCAGCTGAAGATCCTGCAACTGAAGTTCCAGCAGTGTCCCAGAATGCTAGAGCC
AAA
CCCAGCCGACTCCAGGCTTCTGGCTTATCTTCAGAATCAACCAGGCATAATAAAGCTGTTGAGTTTT
CT
TCAGGAGCCAAGTCTCCCTCCAAAAGTGGTGCTCAGACACCCAAAAGTCCCCCAGAACACTATGTCCA
G
GAGACTCCGCTCGTATTCAGCAGGTGTACTTCTGTCAGCTCCCTTGACAGTTTTGAGAGTCGCTCCATT
GCC
AGCTCTGTTCAGAGTGAGCCATGTAGTGGAATGGTGAGTGGCATCATAAGCCCCAGTGACCTTCCAG
AT
AGTCCTGGGCAGACCATGCCACCAAGCAGAAGCAAAACCCCTCCACCTCCTCCACAGACAGTGCAGGC
C
AAGAGAGAGGTGCCAAAAAGTAAAGTCCCTGCTGCTGAGAAGAGAGAGAGTGGGCCTAAGCAGACTGCT
GTA
AATGCTGCCGTGCAGAGGGTGCAGGTCCTTCCAGACGTGGATACTTTGTTACACTTCGCCACAGAAA
GT
ACTCCAGACGGGTTTTCTTGTTCCTCCAGCCTAAGTGCTCTGAGCCTGGATGAGCCATTTATACAGAA
A
GATGTAGAATTAAGAATCATGCCTCCAGTTCAGGAAAACGACAATGGGAATGAAACTGAATCAGAACAG
CCT
GAGGAATCAAATGAAAACCAGGATAAAGAGGTAGAAAAGCCTGACTCTGAAAAAGACTTATTAGATG
AT
TCTGATGACGATGATATTGAAATATTAGAAGAATGTATTATTTCAGCCATGCCAACAAAGTCATCACG
C
AAAGCCAAAAAACTAGCCCAGACTGCTTCAAAATTACCTCCACCTGTGGCAAGGAAACCAAGTCAGCTA
CCT
GTGTATAAACTTCTGCCAGCACAGAATAGGCTGCAGGCACAAAAACATGTTAGCTTTACACCAGGGG
AT
GATGTGCCCCGGGTGTACTGTGTAGAAGGGACACCTATAAACTTTTCCACAGCAACGTCTCTAAGTGA
T
CTGACAATAGAGTCCCCTCCAAATGAATTGGCTACTGGAGATGGGGTCAGAGCGGGTATACAGTCAGGT
GAA
TTTGAAAAACGAGATACCATTCCTACAGAAGGCAGAAGTACAGATGATGCTCAGCGAGGAAAAATCT
CA
TCTATAGTTACACCAGACCTGGATGACAACAAAGCAGAGGAAGGAGATATTCTTGCAGAATGTATCAA
T
TCTGCTATGCCCAAAGGAAAAAGCCACAAGCCTTTCCGAGTGAAAAAGATAATGGACCAAGTCCAACAA
GCA
TCCTCGACTTCATCTGGAGCTAACAAAAATCAAGTAGACACTAAGAAAAAGAAGCCTACTTCACCAG
TA
AAGCCCATGCCACAAAATACTGAATATAGAACGCGTGTGAGAAAGAATACAGACTCAAAAGTTAATGT
A
AATACTGAAGAAACTTTCTCAGACAACAAAGACTCAAAGAAACCAAGCTTACAAACCAATGCCAAGGCC
TTC
AATGAAAAGCTACCTAACAATGAAGACAGAGTGCGGGGGAGCTTCGCCTTGGACTCACCGCATCACT
AC
ACCCCTATTGAGGGGACGCCGTACTGCTTTTCCCGAAATGACTCCTTGAGTTCTCTGGATTTTGATGA
T
GACGATGTTGACCTTTCCAGGGAAAAGGCCGAGTTAAGAAAGGGCAAAGAAAGCAAGGATTCCGAAGCC
AAA
GTTACCTGCCGCCCAGAACCAAACTCAAGCCAGCAGGCAGCTAGTAAGTCACAAGCCAGTATAAAAC
AT
CCAGCAAACAGAGCACAGTCCAAACCAGTGCTGCAGAAACAGCCCACTTTCCCCCAGTCCTCCAAAGA
C
GGACCAGATAGAGGGGCAGCAACTGACGAAAAACTGCAGAATTTTGCTATTGAAAATACTCCAGTTTGC
TTT
TCTCGAAATTCCTCTCTGAGTTCCCTTAGTGACATTGACCAGGAAAACAACAATAACAAAGAAAGTG
AA
CCAATCAAAGAAGCTGAACCTGCCAACTCACAAGGAGAGCCCAGTAAGCCTCAGGCATCCGGGTATGC
T
CCCAAGTCCTTCCACGTCGAAGACACCCCTGTCTGTTTCTCAAGAAACAGCTCTCTCAGTTCTCTTAGC
ATT
GACTCTGAGGACGACCTGTTACAGGAGTGTATAAGTTCTGCCATGCCAAAAAAGAAAAGGCCTTCAA
GA
CTCAAGAGTGAGAGCGAAAAGCAGAGCCCTAGAAAAGTGGGTGGCATATTAGCTGAAGACCTGACGCT
T
GATTTGAAAGATCTACAGAGGCCAGATTCAGAACACGCTTTCTCCCCCGACTCAGAAAATTTTGACTGG
AAA
GCTATTCAGGAAGGCGCAAACTCCATAGTAAGTAGTTTGCACCAAGCTGCTGCAGCCGCCGCGTGCT
TA
TCTAGACAAGCGTCATCCGACTCAGATTCCATTCTGTCACTAAAGTCCGGCATTTCTCTGGGATCGCC
T
TTTCATCTTACACCTGATCAAGAGGAAAAGCCATTCACAAGCAATAAAGGCCCAAGAATTCTCAAACCT
GGA
GAGAAAAGCACATTAGAAGCAAAAAAAATAGAATCTGAAAACAAAGGAATCAAAGGCGGGAAAAAGG
TT
TATAAAAGCTTGATTACGGGAAAGATTCGCTCCAATTCAGAAATTTCCAGCCAAATGAAACAACCCCT
C
CCGACAAACATGCCTTCAATCTCAAGAGGCAGGACGATGATTCACATCCCAGGGCTTCGGAATAGCTCC
TCT
AGTACAAGCCCTGTCTCTAAGAAAGGCCCACCCCTCAAGACTCCAGCCTCTAAAAGCCCCAGTGAAG
GG
CCGGGAGCTACCACTTCTCCTCGAGGAACTAAGCCAGCAGGAAAGTCAGAGCTTAGCCCTATCACCAG
G
CAAACTTCCCAAATCAGTGGGTCAAATAAGGGGTCTTCTAGATCAGGATCTAGAGACTCCACTCCCTCA
AGA
CCTACACAGCAACCATTAAGTAGGCCAATGCAGTCTCCAGGGCGAAACTCAATTTCCCCTGGTAGAA
AT
GGAATAAGCCCTCCTAACAAACTGTCTCAGCTGCCCAGAACATCATCTCCCAGTACTGCTTCAACTAA
G
TCCTCCGGTTCTGGGAAAATGTCATATACATCCCCAGGTAGACAGCTGAGCCAACAAAATCTTACCAAA
CAA
GCAAGTTTATCCAAGAATGCCAGCAGTATCCCCAGAAGTGAGTCGGCATCTAAAGGACTGAATCAGA
TG
AGTAACGGCAATGGGTCAAATAAAAAGGTAGAACTTTCTAGAATGTCTTCAACTAAATCAAGTGGAAG
T
GAATCAGACAGATCAGAAAGGCCTGCATTAGTACGCCAGTCTACTTTCATCAAAGAAGCCCCAAGCCCA
ACC
CTGAGGAGGAAACTGGAGGAATCTGCCTCATTTGAATCCCTTTCTCCATCTTCTAGACCAGATTCTC
CC
ACCAGGTCGCAGGCACAGACCCCAGTTTTAAGCCCTTCCCTTCCTGATATGTCTCTGTCCACACATCC
A
TCTGTTCAGGCAGGTGGGTGGCGAAAGCTCCCGCCTAATCTCAGCCCCACTATCGAGTATAATGACGGA
AGG
CCCACAAAACGGCATGATATTGCACGCTCCCATTCTGAAAGTCCTTCCAGACTACCAATCAACCGGG
CG
GGAACCTGGAAGCGTGAACACAGCAAACATTCCTCGTCCCTTCCTCGAGTGAGTACTTGGAGAAGAAC
T
GGAAGCTCATCTTCTATTCTTTCTGCTTCATCAGAGTCCAGTGAAAAAGCAAAAAGTGAGGATGAAAGG
CAT
GTGAGCTCCATGCCAGCACCCAGACAGATGAAGGAAAACCAGGTGCCCACCAAAGGAACATGGAGGA
AA
ATCAAGGAAAGTGACATTTCTCCCACAGGCATGGCTTCTCAGAGCGCTTCCTCAGGTGCTGCCAGTGG
T
GCTGAATCCAAGCCTCTGATCTATCAGATGGCACCTCCTGTCTCTAAAACAGAGGATGTTTGGGTGAGA
ATT
GAGGACTGCCCCATTAACAACCCTAGATCTGGACGGTCCCCCACAGGCAACACCCCCCCAGTGATTG
AC
AGTGTTTCAGAGAAGGGAAGTTCAAGCATTAAAGATTCAAAAGACACCCATGGGAAACAGAGTGTGGG
C
AGTGGCAGTCCTGTGCAAACCGTGGGTCTGGAAACCCGCCTCAACTCCTTTGTTCAGGTAGAGGCCCCA
GAA
CAGAAAGGAACTGAGGCAAAACCAGGACAGAGTAACCCAGTCTCTATAGCAGAGACTGCTGAGACGT
GT
ATAGCAGAGCGTACCCCTTTCAGTTCCAGTAGCTCCAGCAAGCACAGCTCACCTAGCGGGACTGTTGC
T
GCCAGAGTGACACCTTTTAATTACAACCCTAGCCCTAGGAAGAGCAGCGCAGACAGCACTTCAGCCCGG
CCG
TCTCAGATCCCTACGCCAGTGAGCACCAACACGAAGAAGAGAGATTCGAAGACTGACAGCACAGAAT
CC
AGTGGAGCCCAAAGTCCTAAACGCCATTCCGGGTCTTACCTCGTGACGTCTGTTTAA


Translation (2842 aa):
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDETMTSGQIDLLER
L
K
EFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRTFVNGSRESTGYLEELEKERS
L
LLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTEN
FSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEK
R
AQ
RRIARIQQIEKDILRVRQLLQSQAAEAERSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQSPAT
R
VDHETASVLSSSGTHSAPRRLTSHLGTK
VEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGC
L
PLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWE
W
QEAHEQGMDQDKNP
MPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDH
Y
SVTLRRYAGMALTNLTFGDVANK
ATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKT
L
REVGSVKALMECALEVKK
ESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAII
E
SGGGILRNVSSLIATNEDH
RQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMG
A
VSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSET
F
DNIDNLSPKASHRSKQRHKQNLYGDYAFDANRHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLD
S
SRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQDDRSSASTTEF
H
CVADDRSAARRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPS
V
ESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
K
HVIEDEIKQNEQRQARSQNTSYPVYSENTDDKHLKFQPHFGQQECVSPYRSRGTSGSETNRMGSSHAIN
Q
NVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQ
K
PSFSFSKNSSAQSTKPEHLSPSSENTAVPPSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTY
C
VEDTPICFSRCSSLSSLSSADDEIGCDQTTQEADSANTLQTAEVKENDVTRSAEDPATEVPAVSQNARA
K
PSRLQASGLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSI
A
SSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQAKREVPKSKVPAAEKRESGPKQTA
V
NAAVQRVQVLPDVDTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQ
P
EESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQL
P
VYKLLPAQNRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSG
E
FEKRDTIPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQ
A
SSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSDNKDSKKPSLQTNAKA
F
NEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEA
K
VTCRPEPNSSQQAASKSQASIKHPANRAQSKPVLQKQPTFPQSSKDGPDRGAATDEKLQNFAIENTPVC
F
SRNSSLSSLSDIDQENNNNKESEPIKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLS
I
DSEDDLLQECISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDW
K
AIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKP
G
EKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLPTNMPSISRGRTMIHIPGLRNSS
S
STSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSELSPITRQTSQISGSNKGSSRSGSRDSTPS
R
PTQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTK
Q
ASLSKNASSIPRSESASKGLNQMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSP
T
LRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYNDG
R
PTKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDER
H
VSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSASSGAASGAESKPLIYQMAPPVSKTEDVWVR
I
EDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTHGKQSVGSGSPVQTVGLETRLNSFVQVEAP
E
QKGTEAKPGQSNPVSIAETAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSAR
P
SQIPTPVSTNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser