NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28136.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28136.1 Public Mus musculus 16 Umps 21 106 86 CCDS HistoryNCBI Gene:22247Re-query CCDS DB by CCDS ID:28136.1Re-query CCDS DB by GeneID:22247See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28136.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023510 ENSMUSP00000023510 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023510Link to Ensembl Protein Viewer:ENSMUSP00000023510Re-query CCDS DB by Nucleotide ID:ENSMUST00000023510Re-query CCDS DB by Protein ID:ENSMUSP00000023510
Original member Current member EBI,WTSI OTTMUST00000065699 OTTMUSP00000032775 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065699Link to Vega Protein Viewer:OTTMUSP00000032775Re-query CCDS DB by Nucleotide ID:OTTMUST00000065699Re-query CCDS DB by Protein ID:OTTMUSP00000032775
Original member NCBI NM_009471.2 NP_033497.1 Updated not alive Link to Nucleotide Sequence:NM_009471.2Link to Protein Sequence:NP_033497.1Re-query CCDS DB by Nucleotide ID:NM_009471Re-query CCDS DB by Protein ID:NP_033497
Current member NCBI NM_009471.3 NP_033497.1 Accepted alive Link to Nucleotide Sequence:NM_009471.3Link to Protein Sequence:NP_033497.1Re-query CCDS DB by Nucleotide ID:NM_009471Re-query CCDS DB by Protein ID:NP_033497Link to BLAST:NP_033497.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033497.1 481 P13439 481 100% 0 0

Chromosomal Locations for CCDS 28136.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 33956763 33956935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33959053 33959167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33960177 33960352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33961569 33962240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33963772 33963925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 33966826 33966981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1446 nt):
ATGGAGGTCGCCAGCCAAGCCCTGGGCCCCTTGGTCACCGAGCTGTATGACGTGCAGGCTTTCAAGTTCG
GG
AGCTTCGTCCTGAAGAGCGGGCTCTCCTCCCCAGTCTACATCGACCTGCGGGGCATCGTGTCACGCCC
G
CGTCTTCTCAGTCAGGTCGCAGACATTTTATTCCAGACTGCAAAAAATGCGGGGATCAGTTTTGACAGT
GTG
TGTGGAGTTCCTTATACAGCGTTACCACTGGCGACAGTTATCTGCTCAGCCAATCACATTCCCATGC
TC
ATTAGGAGGAAGGAAACAAAGGATTATGGTACCAAGCGCCTTGTAGAAGGAGAGATTAATCCGGGCCA
G
ACCTGTCTGGTCATTGAGGACGTCGTCACCAGCGGAGCCAGTGTTTTGGAGACTGTGGAAGTTCTTCAG
AAG
GAGGGTCTAAAGGTAACTGATGCCATAGTGCTGTTGGACCGGGAGCAGGGAGGCAAGGACAAGCTGC
AG
GCCCAGGGGATCCGCCTCCACGCCGTGTGCACGCTCTCCCAAATGCTGGAGATTCTCCAGCAGCAGGA
A
AAGATCGACGCTGACATGGTCGGGAGAGTGAAGAGGTTCATTCAGGAGAACGTTTTCTCAGCAGCTAAT
CAT
AACGGTCTCCCCCCTCCTGAGAAGAAAGCGTGCAAAGAACTCAGCTTTGGTGCTCGAGCTGAGCTGC
CT
GGAACCCACCCGCTTGCCTCAAAGCTGCTCCGGCTCATGCAGAAGAAGGAGACCAATCTGTGTCTGTC
T
GCCGATGTGTCGGAGGCCAGGGAGCTGCTGCAGCTCGCAGACGCCTTGGGACCCAGCATCTGCATGCTC
AAA
ACTCATGTCGACATTCTGAATGATTTTACTCTGGATGTGATGGAGGAGTTGACAGCCCTGGCAAAAC
GC
CACGAGTTCTTAATATTTGAAGACAGGAAATTCGCTGATATTGGAAACACAGTTAAAAAGCAGTATGA
A
AGTGGCACCTTTAAAATAGCTTCATGGGCAGATATAGTGAATGCTCACGTCGTGCCAGGCTCAGGAGTT
GTG
AAAGGCTTACAGGAAGTGGGTCTGCCTTTACATCGAGCCTGCCTGCTCATTGCAGAAATGAGCTCTG
CT
GGCTCCTTGGCCACTGGAAACTACACCAAGGCAGCAGTCGGGATGGCTGAGGAGCACTGTGAATTTGT
C
ATTGGCTTCATTTCTGGCTCCCGAGTAAGCATGAAACCAGAGTTTCTTCACTTGACCCCAGGAGTTCAG
TTA
GAAACAGGAGGGGATCACCTTGGCCAGCAGTACAATAGTCCCCAAGAAGTGATCGGGAAACGCGGTT
CT
GATGTCATCATTGTAGGCCGGGGAATACTTGCAGCGGCTAACCGCCTAGAAGCAGCTGAGATGTACAG
G
AAGGCTGCCTGGGAGGCATATCTGAGTAGGCTTGCTGTTCAGTGA


Translation (481 aa):
MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQTAKNAGISFDS
V
CGVPYTALPLATVICSANHIPMLIRRKETKDY
GTKRLVEGEINPGQTCLVIEDVVTSGASVLETVEVLQ
K
EGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQMLEILQQQEKIDADMVGRVKRFIQENVFSAAN
H
NGLPPPEKKACKELSFGARAELPGTHPLASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICML
K
THVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYE
SGTFKIASWADIVNAHVVPGSGV
V
KGLQEVGLPLHRACLLIAEMSSAGSLATGNYTKAA
VGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQ
L
ETG
GDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAVQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser