NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24047.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24047.1 Public Mus musculus 10 Atcay 21 106 86 CCDS HistoryNCBI Gene:16467Re-query CCDS DB by CCDS ID:24047.1Re-query CCDS DB by GeneID:16467See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24047.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047408 ENSMUSP00000036721 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047408Link to Ensembl Protein Viewer:ENSMUSP00000036721Re-query CCDS DB by Nucleotide ID:ENSMUST00000047408Re-query CCDS DB by Protein ID:ENSMUSP00000036721
Original member Current member EBI,WTSI OTTMUST00000075100 OTTMUSP00000039302 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000075100Link to Vega Protein Viewer:OTTMUSP00000039302Re-query CCDS DB by Nucleotide ID:OTTMUST00000075100Re-query CCDS DB by Protein ID:OTTMUSP00000039302
Original member NCBI NM_178662.3 NP_848777.1 Updated not alive Link to Nucleotide Sequence:NM_178662.3Link to Protein Sequence:NP_848777.1Re-query CCDS DB by Nucleotide ID:NM_178662Re-query CCDS DB by Protein ID:NP_848777
Current member NCBI NM_178662.4 NP_848777.1 Accepted alive Link to Nucleotide Sequence:NM_178662.4Link to Protein Sequence:NP_848777.1Re-query CCDS DB by Nucleotide ID:NM_178662Re-query CCDS DB by Protein ID:NP_848777Link to BLAST:NP_848777.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848777.1 372 Q8BHE3 372 100% 0 0

Chromosomal Locations for CCDS 24047.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 81206732 81206741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81207514 81207546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81207834 81207908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81210053 81210088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81210524 81210622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81211846 81211932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81212472 81212603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81212849 81212951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81213223 81213408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81214722 81214943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81219155 81219213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 81224424 81224500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1119 nt):
ATGGGAACCACAGAAGCTACACTAAGGATGGAAAATGTGGACGTGAGGGATGAATGGCAGGATGAGGATC
TG
CCCAGACCGCTCCCAGAAGACACCGGGGTGGAGCGGCTGGGTGGCGCAGTGGAAGACTCCTCCTCACC
T
CCCTCCACCCTGAACTTGAGCGGAGCACATCGAAAGAGAAAGACGCTGGTGGCTCCAGAGATCAACATC
TCC
CTGGACCAAAGCGAGGGCTCTCTGCTGTCCGACGACTTCCTCGACACACCTGATGACCTGGACATCA
AT
GTGGACGACATTGAGACGCCAGATGAAACTGACTCTCTGGAGTTCTTGGGAAATGGCAATGAACTTGA
G
TGGGAAGATGACACCCCAGTGGCCACCGCCAAAAACATGCCTGGTGACAGTGCGGACCTGTTTGGGGAC
GGC
TCTGCGGAAGACGGCAGTGCGGCCAACGGTCGTCTGTGGCGAACTGTCATCATAGGGGAGCAAGAGC
AT
CGCATCGACCTGCATATGATCCGGCCCTACATGAAGGTGGTCACCCATGGAGGATACTACGGGGAAGG
T
CTCAACGCCATCATCGTGTTTGCAGCCTGCTTCCTGCCAGATAGCAGCTCCCCAGACTATCACTACATC
ATG
GAGAATCTCTTCCTGTACGTCATCAGCAGCCTAGAACTGCTCGTGGCTGAGGACTACATGATCGTGT
AT
CTGAACGGCGCCACGCCCCGGAGGAGGATGCCTGGCATTGGTTGGCTGAAGAAGTGTTACCACATGAT
T
GACAGGAGACTGAGGAAGAATCTAAAGTCCCTGATCATCGTCCACCCCTCCTGGTTCATTCGCACTGTG
TTG
GCCATCTCCCGGCCATTCATCAGTGTCAAGTTCATCAGTAAAATTCAGTACGTGCACAGCCTGGAAG
AG
CTGGAGCGACTGATTCCCATGGAACACGTGCAGCTGCCAGACTGTGTCCTGCAATATGAAGAGCAGAG
A
CTCCGAGCCAAGAGGGAGAGCACACGGCCACCGCAGCCGGAGTTCCTCCTTCCCAGGTCAGAAGAAAAG
CCA
GAGACTGTGGAAGAAGAGGACAGGGCAGCAGAGGCAACAGAGGACCAGGAAACTAGCATGTCCTGA


Translation (372 aa):
MGTTEATLRMENVDVRDEWQDEDLPRPLPEDTGVERLGGAVEDSSSPPSTLNLSGAHRKRKTLVAPEINI
S
LDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWE
DDTPVATAKNMPGDSADLFGD
G
SAEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHG
GYYGEGLNAIIVFAACFLPDSSSPDYHYI
M
ENLF
LYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYHMIDRRLRKNLKSLIIVHPSWFIRTV
L
AISRPFI
SVKFISKIQYVHSLEELERLIPMEHVQLPDCVLQYEEQRLRAKRESTRPPQPEFLLPRSEEK
P
ETVEEED
RAAEATEDQETSMS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser