NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23364.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23364.1 Public Mus musculus 9 Slc17a5 21 106 86 CCDS HistoryNCBI Gene:235504Re-query CCDS DB by CCDS ID:23364.1Re-query CCDS DB by GeneID:235504See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23364.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000052441 ENSMUSP00000056182 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000052441Link to Ensembl Protein Viewer:ENSMUSP00000056182Re-query CCDS DB by Nucleotide ID:ENSMUST00000052441Re-query CCDS DB by Protein ID:ENSMUSP00000056182
Original member Current member EBI,WTSI OTTMUST00000076135 OTTMUSP00000040029 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076135Link to Vega Protein Viewer:OTTMUSP00000040029Re-query CCDS DB by Nucleotide ID:OTTMUST00000076135Re-query CCDS DB by Protein ID:OTTMUSP00000040029
Original member Current member NCBI NM_172773.3 NP_766361.1 Accepted alive Link to Nucleotide Sequence:NM_172773.3Link to Protein Sequence:NP_766361.1Re-query CCDS DB by Nucleotide ID:NM_172773Re-query CCDS DB by Protein ID:NP_766361Link to BLink:NP_766361.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766361.1 495 Q8BN82-1 495 100% 0 0

Chromosomal Locations for CCDS 23364.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 78538162 78538299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78540899 78540989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78552934 78553081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78557457 78557589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78559011 78559169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78560688 78560806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78571022 78571108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78574650 78574737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78577030 78577263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78578511 78578707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78587874 78587967 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGAGGCCCCTGCTTCGGGGTCCGGCGGGAAACGACGATGAGGAGAGCTCGGACAGCACCCCGCTCCTGC
CG
GGCGCCCGGCAGACCGAAGCGGCTCCAGTGTGCTGCTCTGCTCGGTACAACTTAGCGATTTTGGCGTT
C
TGTGGTTTCTTCGTTCTCTATGCCTTACGGGTGAACCTGAGTGTTGCGTTAGTGGACATGGTAGATTCA
AAT
ACAACTCTGACTGATAATAGAACGTCTAAGGAGTGTGCGGAACATTCTGCCCCCATAAAAGTTCACC
AC
AATCACACAGGTAAAAAGTACAAGTGGGATGCAGAAACTCAAGGGTGGATTCTCGGCTCTTTTTTTTA
C
GGCTACATCGTCACCCAGATTCCCGGTGGGTACATTGCCAGCAGGGTCGGAGGGAAGCTGCTGCTGGGC
CTG
GGCATCTTAGGCACCTCCGTCTTCACCCTGTTCACACCGCTGGCCGCAGACTTAGGCGTGGTGACTC
TC
GTTGTGCTTAGAGCGCTGGAAGGACTGGGAGAGGGTGTTACGTTTCCAGCTATGCACGCCATGTGGTC
T
TCCTGGGCTCCCCCTCTGGAAAGAAGCAAGCTTCTTACCATTTCCTATGCGGGAGCACAGCTTGGGACA
GTG
ATCTCACTTCCTCTTTCCGGAATAATATGCTACTATATGAACTGGACTTACGTCTTCTATCTTTTTG
GT
ATAGTTGGAATTGTCTGGTTTATTTTATGGATGTGGATAGTCAGTGATACACCAGAAACTCACAAGAC
A
ATCTCCCATTATGAAAAAGAATACATTGTTTCATCATTAAAAAATCAGCTTTCTTCGCAGAAGGTGGTG
CCG
TGGGGGTCCATCTTGAAGTCACTGCCACTTTGGGCAATTGTGGTAGCACATTTCTCCTACAACTGGT
CT
TTTTACACCTTATTGACGCTACTGCCAACTTATATGAAGGAAATCCTAAGGTTCAATGTTCAAGAGAA
C
GGGTTTTTATCTGCATTGCCTTATTTTGGCTGTTGGTTATGCATGATCCTCTGTGGTCAAGCCGCTGAC
TAT
TTAAGGGTCAAGTGGAACTTTTCAACTATAAGCGTTCGGAGAATTTTTAGCCTCGTAGGAATGGTTG
GC
CCTGCGGTTTTCCTAGTCGCGGCTGGATTTATAGGCTGTGACTATTCCTTGGCCGTTGCGTTCCTAAC
C
ATATCCACGACGCTGGGAGGCTTCGCCTCTTCTGGATTTAGCATCAACCATCTGGATATCGCTCCTTCG
TAT
GCTGGCATCCTCTTGGGCATCACAAACACGTTTGCCACTATTCCCGGGATGACGGGACCCATCATTG
CT
AAAAGTCTGACCCCTGATAACACTATTAGGGAATGGCAGACTGTCTTCTGTATCGCTGCTGCTATTAA
C
GTGTTTGGGGCCATTTTCTTCACGCTGTTTGCCAAAGGGGAAGTGCAGAGCTGGGCTCTCAGTGACCAC
CAC
GGACACAGAAACTGA


Translation (495 aa):
MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAILAFCGFFVLYALRVNLSVALVDMVDS
N
TTLTDNRTSKECAEHSAPIKVHHNHT
GKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLG
L
GILGTSVFTLFTPLAADLGVVTLVVLRALEGLGE
GVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGT
V
ISLPLSGIICYYMNWTYVFYLF
GIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKVV
P
WGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQE
NGFLSALPYFGCWLCMILCGQAAD
Y
LRVKWNFSTISVRRIFSLV
GMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPS
Y
AGILLGITNTFATIPGMTGPIIAKSLTPD
NTIREWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSDH
H
GHRN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser