NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22733.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22733.1 Public Mus musculus 8 Zfpm1 21 106 86 CCDS HistoryNCBI Gene:22761Re-query CCDS DB by CCDS ID:22733.1Re-query CCDS DB by GeneID:22761See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22733.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054052 ENSMUSP00000058037 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054052Link to Ensembl Protein Viewer:ENSMUSP00000058037Re-query CCDS DB by Nucleotide ID:ENSMUST00000054052Re-query CCDS DB by Protein ID:ENSMUSP00000058037
Original member Current member EBI,WTSI OTTMUST00000110497 OTTMUSP00000061643 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000110497Link to Vega Protein Viewer:OTTMUSP00000061643Re-query CCDS DB by Nucleotide ID:OTTMUST00000110497Re-query CCDS DB by Protein ID:OTTMUSP00000061643
Original member NCBI NM_009569.3 NP_033595.1 Updated not alive Link to Nucleotide Sequence:NM_009569.3Link to Protein Sequence:NP_033595.1Re-query CCDS DB by Nucleotide ID:NM_009569Re-query CCDS DB by Protein ID:NP_033595
Current member NCBI NM_009569.4 NP_033595.1 Accepted alive Link to Nucleotide Sequence:NM_009569.4Link to Protein Sequence:NP_033595.1Re-query CCDS DB by Nucleotide ID:NM_009569Re-query CCDS DB by Protein ID:NP_033595Link to BLAST:NP_033595.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033595.1 995 O35615 995 100% 0 0

Chromosomal Locations for CCDS 22733.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 122282483 122282522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122305358 122305480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122307492 122307641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122323700 122323833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122332090 122332189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122333721 122333927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122334452 122334682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122334932 122335027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122335113 122335259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 122335432 122337191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2988 nt):
ATGTCCAGGAGGAAACAGAGCAATCCCCGGCAGATCAAGCGTTCCCTCAGAGACATGGAGGCCGGAGAAG
AA
GCCAAGGCCATGGACAGCAGCCCCAAGGAGCAGGAAGCCCCAGACCCAGAGGCCCCAGCCATAGAGGA
G
CCCCCAAGTCCACCCAGAGAAGATGTGAGCCCACCTGCAGTGCCGGCACCTCCGGAGTCCCCAGAAGAT
CCT
GAGGACATGGAGGGGCAGGAGTTGGAGATGAGGCCCCAGGATGAAGAGAAAGAGGAAAAGGAAGAAG
AG
GCAGCCATGGCTAGTCCCTGGAGTGGGCCAGAGGAGCTGGAGCTGGCACTGCAGGATGGGCAGAGGTG
C
GTGCGCGCCCGGCTGAGCCTCACTGAGGGCCTATCCTGGGGCCCATTCTACGGGAGCATCCAGACCAGA
GCC
TTATCCCCTGAGAGAGAAGAACCGGGCCCAGCTGTGACCCTGATGGTGGATGAGAGCTGCTGGCTAA
GG
ATGCTGCCCCAGGTCCTAACTGAAGAAGCCGCCAACTCAGAGATCTACAGGAAGGATGACGCCCTCTG
G
TGCAGGGTTACCAAAGTGGTGCCTTCTGGTGGACTGCTATATGTGCGCCTTGTCACCGAGCCCCATGGT
GCT
CCCAGACACCCTGTGCAGGAACCAGTAGAACCTGGAGGCTTGGCCCCAGTGCACACCGACATCCAGC
TG
CTGCCCCAGCAGGCTGGCATGGCATCCATCCTTGCTACCGCAGTCATCAACAAGGACGTCTTCCCCTG
C
AAAGACTGCGGGATCTGGTACCGTAGTGAGCGGAACCTGCAAGCCCACCTGCTCTACTACTGTGCCAGC
CGC
CAGCGTGCAGGCTCTCCTGTCTCGGCGACGGAAGAGAAACCCAAAGAGACCTACCCCAATGAGCGTG
TC
TGCCCCTTCCCCCAGTGCCGAAAGAGCTGCCCCAGCGCCAGCTCGCTGGAGATCCACATGCGCAGCCA
C
AGTGGAGAGCGCCCCTTCGTGTGCCTCATCTGCCTGTCGGCCTTCACCACCAAGGCCAACTGTGAACGC
CAT
CTCAAGGTGCACACAGACACGCTCAGCGGTGTCTGTCACAACTGTGGCTTCATATCCACCACAAGGG
AC
ATCCTCTACAGTCACCTGGTGACAAACCACATGGTGTGCCAGCCAGGCTCCAAGGGTGAGATCTACTC
A
CCAGGGGCTGGACACCCAGCAGCCAAACTTCCTCCAGACAGCCTGGCAGGCTTTCAACAGCACTCGCTG
ATG
CACAGCCCCCTGGTTCCCGCTGACAAGGCACCCACCCCATCCTCAGGACTGGACAGTAAGGCCGAAG
TC
ACCAACGGAGAGACCAGAGTGCCCCCCCAAAATGGGGGCAGCAGTGAGTCCCCTGCAGCCCCCAGGAC
C
ATCAAGGTGGAGGCTGCAGAGGAGCCTGAAGCCACCCGTGCCTCCGGTCCGGGAGAGCCAGGTCCCCAG
GCT
CCGTCTCGGACACCTTCACCACACAGCCCCAATCCAGTCAGGGTGAAGACAGAACTGTCCAGCCCCA
CG
CCTGGCTCTAGCCCAGGGCCGGGAGAGCTAACAATGGCCGGGACACTCTTTCTGCCACAATATGTGTT
C
AGTCCGGACGCGGGCACAACCACCGTCCCTACGGCGCCACAGGCCTCGGAGATCCTGGCCAAGATGTCC
GAG
TTGGTGCACAACCGGCTACAGCAGGGTGCAGGGAGCTCCGGCGCAGCGGGAACACCCACTGGCCTCT
TC
TCGGGGACTAAGGGTGCCACGTGCTTTGAGTGCGAGATCACCTTTAACAATATCAACAACTTCTATGT
G
CACAAGCGCCTCTACTGCTCGGGCCGCCGCGCGCCCGAGGACCCGCCCACTGTGCGCAGACCCAAAGCG
GCC
ACCGGCCCGGCCCGCGCGCCCGCAGGTGCCGCCGCAGAGCCAGACCCGTCACGCTCGTCGCCGGGGC
CC
GGGCCACGAGAGGAAGAGGCGAGTGGCACGACTACTCCGGAGGCCGAGGCCGCGGGCCGGGGCAGCGA
G
GGCAGCCAGAGCCCGGGCAGCTCCGTAGACGACGCAGAGGACGATCCGAGCCGCACGCTGTGCGAGGCC
TGC
AACATCCGGTTTAGCCGCCACGAAACCTACACTGTGCACAAGCGCTACTACTGCGCCTCGCGCCACG
AC
CCGCCGCCGCGCCGGCCACCCGCACCCACGACCGCACCGGGACCCGCGGCTCCTGCGCTGACAGCGCC
A
CCCGTGCGCACGCGCCGGCGTCGCAAGCTGTACGAGCTGCCCGCAGCTGGCGCCCCGCCCCCAGCCGCA
GGC
CCCGCCCCTGTGCCAGTTGTACCCTCCCCCACTGCGGAGCTGCCCTCTTCTCCGAGACCTGGGAGCG
CC
AGCGCCGGCCCTGCCCCCGCGCTCTCTCCGAGCCCGGTCCCCGACGGCCCCATAGACCTGAGCAAGCG
G
CCGCGTCGCCAGAGCCCGGATGCACCAACAGCTCTGCCCGCGCTGGCCGACTACCACGAGTGTACCGCA
TGT
CGCGTAAGCTTCCACAGCCTCGAAGCTTACCTGGCTCACAAGAAGTACTCATGCCCCGCCGCGCCTT
TG
CGCACCACTGCCCTCTGCCCCTACTGCCCGCCCAACGGGCGCGTTCGCGGCGACCTGGTTGAGCATTT
G
CGCCAGGCACACGGCCTGCAGGTGGCCAAGCCAGCGGCCAGCCCGGGCGCTGAGCCCCGCACACCTGCC
GAG
CGTGCTCCGCGCGACAGCCCCGACGGCCGCGCACCACGCTCTCCTTCCCCTGCTCCCGAGAATACGC
CT
TCTGACCCAGCAGATCAAGGCGCTCGGACACCCAGCAAGGGCCCGCCAGCTCCTGCTCCTGCGCCGGG
T
GGTGGTGGCGGCCACCGCTACTGCCGCCTGTGCAACATCAGGTTCAGCAGCCTGTCCACTTTCATCGCG
CAC
AAGAAGTATTACTGCTCTTCTCACGCCGCCGAGCACGTAAAGTGA


Translation (995 aa):
MSRRKQSNPRQIKRSLRDMEAGEEAKAMDSSPKEQEAPDPEAPAIEEPPSPPREDVSPPAVPAPPESPED
P
EDMEGQELEMRPQDEEKEEKEEEAAMASPWSGP
EELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTR
A
LSPEREEP
GPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGLLYVRLVTEPHG
A
PRHPVQEPVEPGGLAPVHTDIQLLPQQAGMASILATAVIN
KDVFPCKDCGIWYRSERNLQAHLLYYCAS
R
QRAGSPVSATEEKPKETYPNERVCPFPQCRKSCPSASSLEIHMRSHS
GERPFVCLICLSAFTTKANCER
H
LKVHTDTLS
GVCHNCGFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPAAKLPPDSLAGFQQHSL
M
HSPLVPADKAPTPSSGLDSKAEVTNGETRVPPQNGGSSESPAAPRTIKVEAAEEPEATRASGPGEPGPQ
A
PSRTPSPHSPNPVRVKTELSSPTPGSSPGPGELTMAGTLFLPQYVFSPDAGTTTVPTAPQASEILAKMS
E
LVHNRLQQGAGSSGAAGTPTGLFSGTKGATCFECEITFNNINNFYVHKRLYCSGRRAPEDPPTVRRPKA
A
TGPARAPAGAAAEPDPSRSSPGPGPREEEASGTTTPEAEAAGRGSEGSQSPGSSVDDAEDDPSRTLCEA
C
NIRFSRHETYTVHKRYYCASRHDPPPRRPPAPTTAPGPAAPALTAPPVRTRRRRKLYELPAAGAPPPAA
G
PAPVPVVPSPTAELPSSPRPGSASAGPAPALSPSPVPDGPIDLSKRPRRQSPDAPTALPALADYHECTA
C
RVSFHSLEAYLAHKKYSCPAAPLRTTALCPYCPPNGRVRGDLVEHLRQAHGLQVAKPAASPGAEPRTPA
E
RAPRDSPDGRAPRSPSPAPENTPSDPADQGARTPSKGPPAPAPAPGGGGGHRYCRLCNIRFSSLSTFIA
H
KKYYCSSHAAEHVK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser