NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22172.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22172.1 Public Mus musculus 8 Thsd1 21 106 86 CCDS HistoryNCBI Gene:56229Re-query CCDS DB by CCDS ID:22172.1Re-query CCDS DB by GeneID:56229See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22172.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000069828 ENSMUSP00000067701 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000069828Link to Ensembl Protein Viewer:ENSMUSP00000067701Re-query CCDS DB by Nucleotide ID:ENSMUST00000069828Re-query CCDS DB by Protein ID:ENSMUSP00000067701
Original member Current member EBI,WTSI OTTMUST00000067161 OTTMUSP00000033753 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067161Link to Vega Protein Viewer:OTTMUSP00000033753Re-query CCDS DB by Nucleotide ID:OTTMUST00000067161Re-query CCDS DB by Protein ID:OTTMUSP00000033753
Original member Current member NCBI NM_019576.2 NP_062522.1 Accepted alive Link to Nucleotide Sequence:NM_019576.2Link to Protein Sequence:NP_062522.1Re-query CCDS DB by Nucleotide ID:NM_019576Re-query CCDS DB by Protein ID:NP_062522Link to BLAST:NP_062522.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062522.1 851 Q9JM61 851 99.8825% 0 1

Chromosomal Locations for CCDS 22172.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 22238540 22238597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 22242997 22243956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 22252153 22252311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 22258292 22259670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2556 nt):
ATGAAACCCATGTTGAAAGACTTTTCAAATCTCTTGCTGGTGGTGCTCTGTGACTATGTCCTCGGAGAAG
CC
GAATACCTCCTCCTCCAAGAGCCAGTCCATGTGGCACTGAGCGACAGAACGGTGTCAGTGGGTTTCCA
C
TACCTCAGTGACGTCAACGGGACACTGAGGAATGTGTCTGTCATGCTGTGGGAGGCCAACACCAATCGG
ACT
CTTACCACTAAGTACCTCCTGACCAACCAGGCCCAAGGAACACTCCAGTTTGAATGTTTCTACTTCA
AA
GAGGCTGGTGACTACTGGTTTGTAATGATCCCGGAAGTGACAGACAATGGCACGCAAGTTCCACTCTG
G
GAGAAAAGTGCCTTTCTGAAGGTAGAATGGCCTGTCTTTCACATTGATTTAAATAGGACAGCCAAGGCA
GCA
GAAGGCACCTTTCAAGTGGGTGTTTTTACCACCCAACCGCTCTGCCTGTTTCCCGTGGACAAGCCAG
AC
ATGCTGGTGGATGTTATTTTCACTGACCGTCTTCCGGAGGCAAGAGCAAGTTTGGGACAGCCGCTGGA
G
ATCAGAGCCAGCAAAAGGACAAAACTCACTCAAGGTCAGTGGGTCGAGTTTGGCTGTGCACCGGTAGGG
GTG
GAAGCCTACGTTACAGTCATGCTGAGGCTGTTGGGTCAAGACTCAGTCATTGCTTCTACGGGACCTA
TT
GACCTGGCTCAAAAATTCGGATACAAATTGATGATGGCACCGGAAGTCACGTGTGAGTCTGTGCTGGA
G
GTGATGGTACTGCCACCTCCTTGTGTCTTCGTCCAAGGAGTCCTGGCTGTTTACAAAGAAGCCCCCAAA
CGC
CCGGAGGAGAGGACTTTCCAGGTGGCTGAAAACAGACTGCCCCTGGGAGAGAGGAGAACGGTGTTCA
AC
TGCACTTTATTTGATGTAGGGAAGAACAAATACTGTTTTAACTTTGGAATTGTGAAGAAAGGCCATTT
T
TCTGCAAAGGAATGCATGCTAATTCAGAGAAATATAGAAACTTGGGGACCATGGCAGCCGTGGAGCCCG
TGT
AGCACCACGTGCGGGGATGCTGTCCGAGAGCGTCGCCGCCTGTGTGTCACTTCTTTCCCCTCCAGAC
CC
AGCTGCTCTGGAATGTCCTCAGAGACCTCTCCATGCTCCCTGGAGGAGTGTGCTGTTTTCCGGCCACC
A
GGCCCATCGCCTGTTTCACCCCAGGACCCTGTGAAGTCCAACAACGTGGTGACCGTCACAGGGATCTCC
CTG
TGCCTGTTCATCATCTTTGCCACGGTGCTCATCACTCTCTGGAGGAGGTTTGGCCGAGCCCCCAAAT
GC
AGCACGCCCGTTCGCCACAACTCCATCCATTCCCCTGGCTTCCGGAAGAACTCCGATGAAGAGAACAT
C
TGCGAGCTGAGTGAGCCTCGCGGAAGCTTCTCGGATGCCGGTGACGGACCTAGGGGAAGCCCAGGGGAC
ACG
GGCATCCCATTGACTTACAGGTGCAGTGCATCAGCGCCTCCTGAGGATGAGGCCTCGGGCAGTGAGA
GC
TTCCAGTCCAACGCTCAGAAGATCATCCCGCCCTTGTTTAGCTACCGCCTTGCCCAGCAGCAGCTGAA
G
GAGATGAAGAAGAAAGGGCTGACCGAGACCACCAAAGTGTACCACGTATCTCAAAGCCCCCTGACAGAC
ACT
GTAGTGGATGCCACGGCCAGCCCTCCCTTAGACCTGGAATGCCCCGAAGAGGCTGCAGCAAGCAAGT
TC
CGAATCAAATCTCCATTTCTGGACCAGCCTGGGGCAGGTACCGGGGAAAGGCCTCCCTCCAGGCTGGA
T
GGCATCGTGCCTCCTCCTGGCTGTGCGGTCAGTCCCAGCCAGACCCTGATCCGAAAGTCACAGATAAGG
TCG
ACCGGTGGCAGAGATGGCTCATCGGAGAGGTGCCACTCCAGAAGTTCCCTCTTCAGGAGGACTGCTA
GT
TTTCATGAAACCAAGCAGTCTCGCCCTTTCCGGGAGAGGAGTTTGTCAGCCCTGACTCCCCGCCAGGT
C
CCCGCCTACAGTTCCAGGATGCGGACCTGGGACCAGATGGAGGATAGATGTCGGCCTCCCAGTCGAAGT
ACC
CACCTGCTTCCAGAGAGACCAGAGCACTTCCAAGGGGCAGGTCGGACCAGCAGTCCTTTGGGTCCAC
TC
TCCAAATCCTACACTGTGGGGCATCCCAGGAGGAAACCGGACCCAGGGGATCGTCAGGCCGGATTGGT
G
GCAGGAGCTGAGAAAATGGAGCCTCACCGAGCTCACAGGGGACCGTCCCCCAGTCACAGGAGTGCCTCA
AGG
AAGCAGTCTTCCCCCATTTTCCTCAAAGATAGCTACCAGAAAGTCAGTCAGCTTAGCCCTTCTCACT
TC
AGAAAAGATAAATGCCAGAGCTTCCCCATCCACCCCGAGTTCGCCTTCTATGACAATACCTCTTTCCG
C
CTCACCGAGGCTGAGCAGAGAATGCTGGACCTCCCAGGATACTTCGGCTCCAACGAAGAGGACGAAACC
ACA
AGTACACTCAGTGTGGAGAAGTTAGTGATCTAG


Translation (851 aa):
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNR
T
LTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKA
A
EGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVG
V
EAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPK
R
PEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNI
ETWGPWQPWSP
C
STTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECA
VFRPPGPSPVSPQDPVKSNNVVTVTGIS
L
CLFIIFATVLITLWRRFGRAPKCSTPVRHNSIHSPGFRKNSDEENICELSEPRGSFSDAGDGPRGSPGD
T
GIPLTYRCSASAPPEDEASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTD
T
VVDATASPPLDLECPEEAAASKFRIKSPFLDQPGAGTGERPPSRLDGIVPPPGCAVSPSQTLIRKSQIR
S
TGGRDGSSERCHSRSSLFRRTASFHETKQSRPFRERSLSALTPRQVPAYSSRMRTWDQMEDRCRPPSRS
T
HLLPERPEHFQGAGRTSSPLGPLSKSYTVGHPRRKPDPGDRQAGLVAGAEKMEPHRAHRGPSPSHRSAS
R
KQSSPIFLKDSYQKVSQLSPSHFRKDKCQSFPIHPEFAFYDNTSFRLTEAEQRMLDLPGYFGSNEEDET
T
STLSVEKLVI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser