NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS21.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21.1 Public Homo sapiens 1 INTS11 22 109 92 CCDS HistoryNCBI Gene:54973Re-query CCDS DB by CCDS ID:21.1Re-query CCDS DB by GeneID:54973See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000435064.5 ENSP00000413493.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000435064.5Link to Ensembl Protein Viewer:ENSP00000413493.1Re-query CCDS DB by Nucleotide ID:ENST00000435064Re-query CCDS DB by Protein ID:ENSP00000413493
Original member NCBI NM_017871.5 NP_060341.2 Updated not alive Link to Nucleotide Sequence:NM_017871.5Link to Protein Sequence:NP_060341.2Re-query CCDS DB by Nucleotide ID:NM_017871Re-query CCDS DB by Protein ID:NP_060341
Current member NCBI NM_017871.6 NP_060341.2 Accepted alive Link to Nucleotide Sequence:NM_017871.6Link to Protein Sequence:NP_060341.2Re-query CCDS DB by Nucleotide ID:NM_017871Re-query CCDS DB by Protein ID:NP_060341Link to BLAST:NP_060341.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060341.2 600 Q5TA45-1 600 100% 0 0

Chromosomal Locations for CCDS 21.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 1311859 1311924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1312018 1312147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1312226 1312368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1312440 1312501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1312593 1312700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1312787 1312949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1313035 1313124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1313509 1313592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1313732 1313921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1314301 1314365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1314824 1314962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1315404 1315438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1315520 1315618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1319296 1319524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1320456 1320529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1320996 1321093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 1324581 1324608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1803 nt):
ATGCCTGAGATCAGAGTCACGCCCTTGGGGGCCGGCCAGGACGTGGGCCGAAGCTGCATCCTGGTCTCCA
TT
GCGGGCAAGAATGTCATGCTGGACTGTGGAATGCACATGGGCTTCAATGACGACCGACGCTTCCCTGA
C
TTCTCCTACATCACCCAGAACGGCCGCCTAACAGACTTCCTGGACTGTGTGATCATTAGCCACTTCCAC
CTG
GACCACTGCGGGGCACTCCCCTACTTCAGCGAGATGGTGGGCTACGACGGGCCCATCTACATGACTC
AC
CCCACCCAGGCCATCTGCCCCATCTTGCTGGAGGACTACCGCAAGATCGCCGTAGACAAGAAGGGCGA
G
GCCAACTTCTTCACCTCCCAGATGATCAAAGACTGCATGAAGAAGGTGGTGGCTGTCCACCTCCACCAG
ACG
GTCCAGGTAGATGATGAGCTGGAGATCAAGGCCTACTATGCAGGCCACGTGCTGGGGGCAGCCATGT
TC
CAGATTAAAGTGGGCTCAGAGTCTGTGGTCTACACGGGTGATTATAACATGACCCCAGACCGACACTT
A
GGAGCTGCCTGGATTGACAAGTGCCGCCCCAACCTGCTCATCACAGAGTCCACGTACGCCACGACCATC
CGT
GACTCCAAGCGCTGCCGGGAGCGAGACTTCCTGAAGAAAGTCCACGAGACCGTGGAGCGTGGTGGGA
AG
GTGCTGATACCTGTGTTCGCGCTGGGCCGCGCCCAGGAGCTCTGCATCCTCCTGGAGACCTTCTGGGA
G
CGCATGAACCTGAAGGTGCCCATCTACTTCTCCACGGGGCTGACCGAGAAGGCCAACCACTACTACAAG
CTG
TTCATCCCCTGGACCAACCAGAAGATCCGCAAGACTTTCGTGCAGAGGAACATGTTTGAGTTCAAGC
AC
ATCAAGGCCTTCGACCGGGCTTTTGCTGACAACCCAGGACCGATGGTTGTGTTTGCCACGCCAGGAAT
G
CTGCACGCTGGGCAGTCCCTGCAGATCTTCCGGAAATGGGCCGGAAACGAAAAGAACATGGTCATCATG
CCC
GGCTACTGCGTGCAGGGCACCGTCGGCCACAAGATCCTCAGCGGGCAGCGGAAGCTCGAGATGGAGG
GG
CGGCAGGTGCTGGAGGTCAAGATGCAGGTGGAGTACATGTCATTCAGCGCACACGCGGACGCCAAGGG
C
ATCATGCAGCTGGTGGGCCAGGCAGAGCCGGAGAGCGTGCTGCTGGTGCATGGCGAGGCCAAGAAGATG
GAG
TTCCTGAAGCAGAAGATCGAGCAGGAGCTCCGGGTCAACTGCTACATGCCGGCCAATGGCGAGACGG
TG
ACGCTGCCCACAAGCCCCAGCATCCCCGTAGGCATCTCGCTGGGGCTGCTGAAGCGGGAGATGGCGCA
G
GGGCTGCTCCCTGAGGCCAAGAAGCCTCGGCTCCTGCACGGCACCCTGATCATGAAGGACAGCAACTTC
CGG
CTGGTGTCCTCAGAGCAAGCCCTCAAAGAGCTGGGTCTGGCTGAGCACCAGCTGCGCTTCACCTGCC
GC
GTGCACCTGCATGACACACGCAAGGAGCAGGAGACGGCATTGCGCGTCTACAGCCACCTCAAGAGCGT
C
CTGAAGGACCACTGTGTGCAGCACCTCCCAGACGGCTCTGTGACTGTGGAGTCCGTCCTCCTCCAGGCC
GCC
GCCCCTTCTGAGGACCCAGGCACCAAGGTGCTGCTGGTCTCCTGGACCTACCAGGACGAGGAGCTGG
GG
AGCTTCCTCACATCTCTGCTGAAGAAGGGCCTCCCCCAGGCCCCCAGCTGA


Translation (600 aa):
MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFH
L
DHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQ
T
VQ
VDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTI
R
DSKRCRERDFLKKVHETVERGGK
VLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYK
L
FIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPM
VVFATPGMLHAGQSLQIFRKWAGNEKNMVIM
P
GYCVQGTVGHKILSGQRKLEMEGRQV
LEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKM
E
FLKQKIEQEL
RVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNF
R
LVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLK
SVLKDHCVQHLPDGSVTVESVLLQA
A
APSEDPGTKVLLVSWTYQ
DEELGSFLTSLLKKGLPQAPS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser