NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2014.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2014.1 Public Homo sapiens 2 FAHD2A 22 109 92 CCDS HistoryNCBI Gene:51011Re-query CCDS DB by CCDS ID:2014.1Re-query CCDS DB by GeneID:51011See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2014.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000233379.8 ENSP00000233379.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000233379.8Link to Ensembl Protein Viewer:ENSP00000233379.4Re-query CCDS DB by Nucleotide ID:ENST00000233379Re-query CCDS DB by Protein ID:ENSP00000233379
Original member Current member EBI,WTSI ENST00000447036.5 ENSP00000406424.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000447036.5Link to Ensembl Protein Viewer:ENSP00000406424.1Re-query CCDS DB by Nucleotide ID:ENST00000447036Re-query CCDS DB by Protein ID:ENSP00000406424
Original member Current member NCBI NM_016044.2 NP_057128.2 Accepted alive Link to Nucleotide Sequence:NM_016044.2Link to Protein Sequence:NP_057128.2Re-query CCDS DB by Nucleotide ID:NM_016044Re-query CCDS DB by Protein ID:NP_057128Link to BLAST:NP_057128.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057128.2 314 Q96GK7 314 100% 0 0

Chromosomal Locations for CCDS 2014.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 95405559 95405803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95406941 95407157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95410527 95410586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95410864 95411026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95412434 95412542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95412677 95412764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 95412895 95412957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGCTGGTGTCTGGTAGAAGAAGGTTACTCACAGTTCTGCTGCAGGCTCAGAAGTGGCCCTTTCAACCCT
CC
AGAGACATGAGACTAGTGCAGTTCCGGGCACCCCACCTGGTGGGGCCTCACTTGGGCCTGGAGACAGG
G
AATGGTGGAGGGGTTATCAACCTCAATGCCTTTGACCCCACACTCCCGAAGACGATGACGCAGTTCCTA
GAG
CAGGGAGAGGCCACCCTCTCAGTGGCAAGAAGAGCCCTGGCTGCCCAGTTGCCAGTCCTACCACGGT
CG
GAGGTAACCTTCCTGGCTCCAGTCACACGACCAGATAAGGTGGTGTGTGTGGGCATGAATTATGTGGA
C
CACTGCAAAGAACAGAACGTGCCCGTGCCCAAGGAGCCCATCATCTTCAGCAAGTTTGCCAGCTCCATC
GTG
GGGCCCTATGATGAGGTGGTCCTCCCACCACAGAGCCAGGAGGTAGATTGGGAAGTGGAGCTGGCCG
TG
GTCATTGGAAAGAAAGGCAAGCACATCAAGGCCACAGATGCTATGGCCCACGTGGCCGGCTTCACTGT
G
GCTCATGACGTGAGTGCTCGTGACTGGCAAATGAGACGTAATGGGAAACAATGGCTGCTGGGAAAAACC
TTC
GACACCTTCTGCCCTCTGGGCCCTGCCTTGGTGACCAAGGACAGTGTAGCAGATCCACACAACTTAA
AG
ATCTGCTGCCGAGTGAATGGGGAAGTGGTCCAGAGCGGCAACACCAACCAGATGGTATTCAAGACAGA
G
GACCTGATAGCCTGGGTCTCCCAGTTTGTTACCTTTTACCCAGGGGATGTCATCCTAACTGGGACCCCC
CCA
GGTGTCGGTGTATTCAGGAAACCTCCTGTCTTTCTCAAGAAGGGGGATGAAGTCCAGTGTGAGATTG
AA
GAACTAGGTGTCATCATCAACAAGGTGGTGTGA


Translation (314 aa):
MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL
E
QGEATLSVAR
RALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI
V
GPYDEVVLPPQSQ
EVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKT
F
DTFCPLGPALVTKDSVA
DPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP
P
GVGVFRKPPVFLK
KGDEVQCEIEELGVIINKVV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser