NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1983.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1983.2 Public Homo sapiens 2 SFTPB 20 108 85 CCDS HistoryNCBI Gene:6439Re-query CCDS DB by CCDS ID:1983.2Re-query CCDS DB by GeneID:6439See the combined annotation on chromosome 2 in Sequence Viewer

Public Note for CCDS 1983.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation data. The upstream AUG of the updated CCDS has a weak Kozak sequence and it is conserved among primates. The protein encoded by the update has a 36 aa signal peptide which is longer than average but this could still, feasibly, target it for secretion. It is possible that, due to leaky scanning, sometimes a ribosome will translate from the downstream AUG producing a protein with a 24 aa signal peptide so potentially both forms could be secreted. There is published evidence (e.g. PMID: 18828060 and PMID: 17507829) supporting the secretion of this protein.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 1983.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000409383 ENSP00000386346 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409383Link to Ensembl Protein Viewer:ENSP00000386346Re-query CCDS DB by Nucleotide ID:ENST00000409383Re-query CCDS DB by Protein ID:ENSP00000386346
Original member Current member EBI,WTSI OTTHUMT00000329848 OTTHUMP00000203253 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000329848Link to Vega Protein Viewer:OTTHUMP00000203253Re-query CCDS DB by Nucleotide ID:OTTHUMT00000329848Re-query CCDS DB by Protein ID:OTTHUMP00000203253
Original member Current member NCBI NM_000542.3 NP_000533.3 Accepted alive Link to Nucleotide Sequence:NM_000542.3Link to Protein Sequence:NP_000533.3Re-query CCDS DB by Nucleotide ID:NM_000542Re-query CCDS DB by Protein ID:NP_000533Link to BLAST:NP_000533.3
Original member Current member NCBI NM_198843.2 NP_942140.2 Accepted alive Link to Nucleotide Sequence:NM_198843.2Link to Protein Sequence:NP_942140.2Re-query CCDS DB by Nucleotide ID:NM_198843Re-query CCDS DB by Protein ID:NP_942140Link to BLAST:NP_942140.2

Chromosomal Locations for CCDS 1983.2

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 85661473 85661535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85662029 85662109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85663346 85663491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85663664 85663847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85665289 85665378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85665606 85665794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85666617 85666742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85667106 85667177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85667679 85667806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 85668117 85668219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1182 nt):
ATGCACCAAGCAGGGTACCCAGGCTGCAGAGGTGCCATGGCTGAGTCACACCTGCTGCAGTGGCTGCTGC
TG
CTGCTGCCCACGCTCTGTGGCCCAGGCACTGCTGCCTGGACCACCTCATCCTTGGCCTGTGCCCAGGG
C
CCTGAGTTCTGGTGCCAAAGCCTGGAGCAAGCATTGCAGTGCAGAGCCCTAGGGCATTGCCTACAGGAA
GTC
TGGGGACATGTGGGAGCCGATGACCTATGCCAAGAGTGTGAGGACATCGTCCACATCCTTAACAAGA
TG
GCCAAGGAGGCCATTTTCCAGGACACGATGAGGAAGTTCCTGGAGCAGGAGTGCAACGTCCTCCCCTT
G
AAGCTGCTCATGCCCCAGTGCAACCAAGTGCTTGACGACTACTTCCCCCTGGTCATCGACTACTTCCAG
AAC
CAGACTGACTCAAACGGCATCTGTATGCACCTGGGCCTGTGCAAATCCCGGCAGCCAGAGCCAGAGC
AG
GAGCCAGGGATGTCAGACCCCCTGCCCAAACCTCTGCGGGACCCTCTGCCAGACCCTCTGCTGGACAA
G
CTCGTCCTCCCTGTGCTGCCCGGGGCCCTCCAGGCGAGGCCTGGGCCTCACACACAGGATCTCTCCGAG
CAG
CAATTCCCCATTCCTCTCCCCTATTGCTGGCTCTGCAGGGCTCTGATCAAGCGGATCCAAGCCATGA
TT
CCCAAGGGTGCGCTAGCTGTGGCAGTGGCCCAGGTGTGCCGCGTGGTACCTCTGGTGGCGGGCGGCAT
C
TGCCAGTGCCTGGCTGAGCGCTACTCCGTCATCCTGCTCGACACGCTGCTGGGCCGCATGCTGCCCCAG
CTG
GTCTGCCGCCTCGTCCTCCGGTGCTCCATGGATGACAGCGCTGGCCCAAGGTCGCCGACAGGAGAAT
GG
CTGCCGCGAGACTCTGAGTGCCACCTCTGCATGTCCGTGACCACCCAGGCCGGGAACAGCAGCGAGCA
G
GCCATACCACAGGCAATGCTCCAGGCCTGTGTTGGCTCCTGGCTGGACAGGGAAAAGTGCAAGCAATTT
GTG
GAGCAGCACACGCCCCAGCTGCTGACCCTGGTGCCCAGGGGCTGGGATGCCCACACCACCTGCCAGG
CC
CTCGGGGTGTGTGGGACCATGTCCAGCCCTCTCCAGTGTATCCACAGCCCCGACCTTTGA


Translation (393 aa):
MHQAGYPGCRGAMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQE
V
WGHVGA
DDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQ
N
QT
DSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSE
Q
QFPIPLPYCWLCRALIKRIQAMIPK
GALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQ
L
VCRLVLRCSMDDSAGP
RSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQF
V
EQHTPQLLTLVPRGWDAHTTCQ
ALGVCGTMSSPLQCIHSPDL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser