NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17744.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17744.1 Public Mus musculus 3 Gstm3 21 106 86 CCDS HistoryNCBI Gene:14864Re-query CCDS DB by CCDS ID:17744.1Re-query CCDS DB by GeneID:14864See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17744.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004136 ENSMUSP00000004136 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004136Link to Ensembl Protein Viewer:ENSMUSP00000004136Re-query CCDS DB by Nucleotide ID:ENSMUST00000004136Re-query CCDS DB by Protein ID:ENSMUSP00000004136
Original member Current member EBI,WTSI OTTMUST00000016604 OTTMUSP00000007638 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000016604Link to Vega Protein Viewer:OTTMUSP00000007638Re-query CCDS DB by Nucleotide ID:OTTMUST00000016604Re-query CCDS DB by Protein ID:OTTMUSP00000007638
Original member Current member NCBI NM_010359.2 NP_034489.1 Accepted alive Link to Nucleotide Sequence:NM_010359.2Link to Protein Sequence:NP_034489.1Re-query CCDS DB by Nucleotide ID:NM_010359Re-query CCDS DB by Protein ID:NP_034489Link to BLAST:NP_034489.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034489.1 218 P19639 218 100% 0 0

Chromosomal Locations for CCDS 17744.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 107964207 107964296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107966087 107966197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107966279 107966374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107967575 107967675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107967766 107967847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107968136 107968200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107968763 107968838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 107969105 107969140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (657 nt):
ATGCCTATGACACTGGGCTATTGGAACACCCGCGGACTGACTCACTCCATCCGCTTGCTCCTGGAATACA
CA
GATTCAAGCTATGAGGAGAAGAGATATGTCATGGGGGATGCCCCCAACTTTGACCGAAGCCAGTGGCT
G
AGTGAGAAATTCAATCTTGGCCTGGATTTTCCCAATCTGCCCTACTTAATTGATGGGTCACACAAGGTC
ACC
CAGAGCAATGCCATCCTGCGCTACCTTGGCCGGAAGCACAACCTGTGTGGAGAGACAGAGGAGGAGA
GG
ATCCGTGTGGATACTTTGGAGAACCAAGTTATGGACACCCGCATACAGCTCATGATAGTCTGCTGCAG
T
CCCGATTTTGAGAAGCAGAAGCCAGAGTTCTTGAAGGCCATCCCTGAGAAAATGAAGCTCTACTCTGAG
TTC
CTGGGCAAGAGGCCATGGTTTGCAGGGGACAAGGTCACCTATGTGGATTTCCTTGCTTATGACATTC
TT
GACCAGTATCGTATGTTTGAGCCCAAGTGCCTGGACGCCTTCCCAAACCTGAGGGACTTCCTGGCCCG
C
TTCGAGGGCCTCAAGAAGATCTCTGCCTACATGAAGAGTAGCCGCTTCCTCCCAAGACCTGTGTTTACT
AAG
ATAGCCCAGTGGGGCACTGATTAG


Translation (218 aa):
MPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKV
T
QSNAILRYLGRKHNL
CGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSE
F
LGKRPWFAGDK
VTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFT
K
IAQWGTD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser