NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17196.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17196.1 Public Mus musculus 2 Kcnq2 21 106 86 CCDS HistoryNCBI Gene:16536Re-query CCDS DB by CCDS ID:17196.1Re-query CCDS DB by GeneID:16536See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17196.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000103048 ENSMUSP00000099337 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000103048Link to Ensembl Protein Viewer:ENSMUSP00000099337Re-query CCDS DB by Nucleotide ID:ENSMUST00000103048Re-query CCDS DB by Protein ID:ENSMUSP00000099337
Original member Current member EBI,WTSI OTTMUST00000040020 OTTMUSP00000017856 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040020Link to Vega Protein Viewer:OTTMUSP00000017856Re-query CCDS DB by Nucleotide ID:OTTMUST00000040020Re-query CCDS DB by Protein ID:OTTMUSP00000017856
Original member Current member NCBI NM_001006669.2 NP_001006670.1 Accepted alive Link to Nucleotide Sequence:NM_001006669.2Link to Protein Sequence:NP_001006670.1Re-query CCDS DB by Nucleotide ID:NM_001006669Re-query CCDS DB by Protein ID:NP_001006670Link to BLink:NP_001006670.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001006670.1 723 Q9Z351-4 723 99.7234% 0 2

Chromosomal Locations for CCDS 17196.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 181076158 181076202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181081455 181081775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181082333 181082456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181086969 181087100 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181087575 181087683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181088347 181088570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181096950 181096979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181100550 181100618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181104887 181104981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181109022 181109117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181109675 181109785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181112000 181112125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181113063 181113238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181113572 181113698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181114639 181114729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 181134797 181135092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2172 nt):
ATGGTGCAGAAGTCGCGCAACGGTGGCGTGTACCCCGGCACCAGCGGGGAAAAGAAGCTCAAGGTGGGCT
TC
GTGGGGCTGGACCCCGGCGCGCCCGACTCCACACGCGACGGCGCGCTACTCATCGCGGGCTCCGAGGC
C
CCCAAGCGCGGCAGCGTTTTGAGCAAGCCGCGGACGGGCGGCGCGGGAGCCGGGAAGCCCCCGAAGCGC
AAC
GCCTTCTACCGCAAGCTGCAGAATTTCCTCTACAACGTGCTAGAGCGGCCCCGCGGCTGGGCGTTCA
TC
TACCACGCCTACGTGTTCCTTTTAGTCTTCTCCTGCCTTGTGCTTTCTGTGTTTTCCACCATCAAGGA
G
TACGAGAAGAGCTCTGAGGGGGCCCTCTACATCTTGGAAATCGTGACTATCGTGGTATTCGGTGTTGAG
TAC
TTTGTGAGGATCTGGGCTGCAGGCTGCTGTTGCCGGTATCGAGGCTGGAGGGGCAGGCTCAAGTTTG
CC
AGGAAGCCGTTCTGTGTGATTGATATCATGGTGCTGATTGCCTCCATTGCTGTGCTGGCTGCTGGTTC
C
CAGGGCAATGTCTTTGCCACATCTGCGCTTCGGAGCTTGCGGTTCTTGCAAATCTTGCGGATGATCCGT
ATG
GACCGGAGGGGTGGCACCTGGAAGCTCTTGGGATCGGTAGTCTACGCTCACAGCAAGGAGCTGGTGA
CT
GCCTGGTACATTGGCTTCCTCTGCCTCATCCTGGCCTCATTTCTGGTGTACTTGGCAGAAAAGGGTGA
G
AATGACCACTTTGACACCTACGCAGATGCACTCTGGTGGGGTCTGATCACCCTGACGACCATTGGCTAC
GGG
GACAAGTACCCTCAGACCTGGAACGGGAGGCTGCTGGCAGCGACCTTTACCCTCATTGGTGTCTCGT
TC
TTTGCTCTTCCTGCTGGCATTTTGGGATCCGGCTTTGCCCTGAAAGTCCAAGAGCAGCATCGGCAAAA
A
CACTTTGAGAAACGGCGGAACCCTGCGGCAGGTCTGATCCAGTCTGCCTGGAGATTCTATGCTACTAAC
CTC
TCACGCACCGACCTGCACTCCACGTGGCAGTACTACGAGCGGACAGTCACTGTCCCCATGTACAGAC
TC
ATCCCACCTCTGAACCAGCTGGAGCTGCTGAGGAATCTCAAGAGCAAATCTGGACTCACCTTCAGGAA
G
GAGCCACAGCCAGAGCCATCACCAAGTCAGAAGGTCAGTTTGAAAGATCGTGTCTTCTCCAGCCCCCGA
GGC
ATGGCTGCCAAGGGAAAGGGGTCTCCCCAGGCCCAGACGGTCCGGCGGTCCCCCAGTGCGGATCAGA
GT
CTTGATGACAGCCCGAGCAAGGTGCCCAAGAGCTGGAGCTTTGGTGACCGCAGCCGCACACGCCAGGC
T
TTCCGCATCAAGGGTGCTGCATCCCGGCAGAATTCAGAAGAAGCAAGCCTCCCTGGGGAGGACATCGTA
GAG
GACAACAAGAGCTGTAACTGCGAGTTTGTGACTGAAGATCTTACCCCTGGCCTCAAAGTTAGCATCA
GA
GCTGTGTGTGTTATGCGGTTCTTGGTATCTAAGCGAAAGTTCAAAGAGAGTCTGCGCCCATATGATGT
G
ATGGACGTCATCGAACAGTACTCGGCTGGACACTTGGATATGTTGTCCCGCATCAAGAGCCTGCAGTCC
AG
A
GTGGACCAGATTGTGGGGCGGGGCCCAACAATAACGGATAAGGACCGCACCAAAGGCCCAGCGGAAA
CG
GAGCTGCCCGAAGACCCCAGCATGATGGGACGGCTTGGGAAGGTGGAGAAACAGGTCTTGTCCATGGA
A
AAGAAGCTCGACTTCTTGGTGAGCATCTATACACAGAGAATGGGCATCCCACCAGCAGAGACAGAGGCC
TAT
TTTGGGGCCAAGGAGCCTGAGCCGGCACCACCCTACCACAGCCCAGAGGACAGCCGTGACCATGCAG
AC
AAGCATGGCTGTATCATTAAGATCGTCCGCTCCACCAGCTCTACGGGCCAGAGGAACTACGCAGCACC
C
CCAGCCATCCCCCCTGCCCAGTGTCCTCCCTCCACCTCGTGGCAGCAGAGCCACCAGCGCCATGGCACC
TCC
CCTGTGGGAGACCATGGCTCACTGGTCCTGCGACTGGAGAGGAGTGCTGGCATGATGAGCTGTCACT
AG


Translation (723 aa):
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTGGAGAGKPPKR
N
AFYRKLQNFLYNVLERPRGWAFIYHAY
VFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVE
Y
FVRIWAAGCCCRYRGWRGRLKFARKPFCVI
DIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIR
M
DRRGGTWKLLGSVVYAHSK
ELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGY
G
DKYPQTWNGRLLAATFTLIGVSFFALPA
GILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATN
L
SRTDLHSTWQYYERTVTVPMY
RLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVSLKDRVFSSPR
G
MAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSE
EASLPGEDIV
E
DNKSCNCEFVTEDLTPGLKVSIRAV
CVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQS
R
VDQIVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEA
Y
FGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGT
S
PVGDHGSL
VLRLERSAGMMSCH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser