NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14529.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14529.1 Public Homo sapiens X PRPS1 20 108 85 CCDS HistoryNCBI Gene:5631Re-query CCDS DB by CCDS ID:14529.1Re-query CCDS DB by GeneID:5631See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14529.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372435 ENSP00000361512 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372435Link to Ensembl Protein Viewer:ENSP00000361512Re-query CCDS DB by Nucleotide ID:ENST00000372435Re-query CCDS DB by Protein ID:ENSP00000361512
Original member Current member EBI,WTSI OTTHUMT00000057840 OTTHUMP00000023807 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000057840Link to Vega Protein Viewer:OTTHUMP00000023807Re-query CCDS DB by Nucleotide ID:OTTHUMT00000057840Re-query CCDS DB by Protein ID:OTTHUMP00000023807
Original member Current member NCBI NM_002764.3 NP_002755.1 Accepted alive Link to Nucleotide Sequence:NM_002764.3Link to Protein Sequence:NP_002755.1Re-query CCDS DB by Nucleotide ID:NM_002764Re-query CCDS DB by Protein ID:NP_002755Link to BLAST:NP_002755.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002755.1 318 P60891-1 318 100% 0 0

Chromosomal Locations for CCDS 14529.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 107628629 107628750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107639295 107639478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107640902 107641000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107642366 107642490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107645177 107645350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107647606 107647765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 107649940 107650032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (957 nt):
ATGCCGAATATCAAAATCTTCAGCGGCAGCTCCCACCAGGACTTATCTCAGAAAATTGCTGACCGCCTGG
GC
CTGGAGCTAGGCAAGGTGGTGACTAAGAAATTCAGCAACCAGGAGACCTGTGTGGAAATTGGTGAAAG
T
GTACGTGGAGAGGATGTCTACATTGTTCAGAGTGGTTGTGGCGAAATCAATGACAATTTAATGGAGCTT
TTG
ATCATGATTAATGCCTGCAAGATTGCTTCAGCCAGCCGGGTTACTGCAGTCATCCCATGCTTCCCTT
AT
GCCCGGCAGGATAAGAAAGATAAGAGCCGGGCGCCAATCTCAGCCAAGCTTGTTGCAAATATGCTATC
T
GTAGCAGGTGCAGATCATATTATCACCATGGACCTACATGCTTCTCAAATTCAGGGCTTTTTTGATATC
CCA
GTAGACAATTTGTATGCAGAGCCGGCTGTCCTAAAGTGGATAAGGGAGAATATCTCTGAGTGGAGGA
AC
TGCACTATTGTCTCACCTGATGCTGGTGGAGCTAAGAGAGTGACCTCCATTGCAGACAGGCTGAATGT
G
GACTTTGCCTTGATTCACAAAGAACGGAAGAAGGCCAATGAAGTGGACCGCATGGTGCTTGTGGGAGAT
GTG
AAGGATCGGGTGGCCATCCTTGTGGATGACATGGCTGACACTTGTGGCACAATCTGCCATGCAGCTG
AC
AAACTTCTCTCAGCTGGCGCCACCAGAGTTTATGCCATCTTGACTCATGGAATCTTCTCCGGTCCTGC
T
ATTTCTCGCATCAACAACGCATGCTTTGAGGCAGTAGTAGTCACCAATACCATACCTCAGGAGGACAAG
ATG
AAGCATTGCTCCAAAATACAGGTGATTGACATCTCTATGATCCTTGCAGAAGCCATCAGGAGAACTC
AC
AATGGAGAATCCGTTTCTTACCTATTCAGCCATGTCCCTTTATAA


Translation (318 aa):
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMEL
L
IMINACKIASASRVTAVIPCFPYARQDKKDK
SRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDI
P
VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAK
RVTSIADRLNVDFALIHKERKKANEVDRMVLVGD
V
KDRVAILVDDMADTCGTICHAAD
KLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDK
M
KHCSKIQ
VIDISMILAEAIRRTHNGESVSYLFSHVPL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser