NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14478.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14478.1 Public Homo sapiens X TMEM35A 22 109 92 CCDS HistoryNCBI Gene:59353Re-query CCDS DB by CCDS ID:14478.1Re-query CCDS DB by GeneID:59353See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14478.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372930.4 ENSP00000362021.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372930.4Link to Ensembl Protein Viewer:ENSP00000362021.4Re-query CCDS DB by Nucleotide ID:ENST00000372930Re-query CCDS DB by Protein ID:ENSP00000362021
Original member Current member NCBI NM_021637.2 NP_067650.1 Accepted alive Link to Nucleotide Sequence:NM_021637.2Link to Protein Sequence:NP_067650.1Re-query CCDS DB by Nucleotide ID:NM_021637Re-query CCDS DB by Protein ID:NP_067650Link to BLAST:NP_067650.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067650.1 167 Q53FP2 167 100% 0 0

Chromosomal Locations for CCDS 14478.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 101079003 101079122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 101094573 101094956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (504 nt):
ATGGCATCCCCCAGAACCGTAACTATTGTGGCCCTCTCAGTGGCCCTGGGACTCTTCTTTGTTTTCATGG
GG
ACTATCAAGCTGACCCCCAGGCTCAGCAAGGATGCCTACAGTGAGATGAAACGTGCTTACAAGAGCTA
T
GTTCGAGCCCTCCCTCTGCTGAAGAAAATGGGGATCAATTCCATTCTCCTCCGAAAAAGCATTGGTGCC
CTT
GAAGTGGCCTGTGGCATCGTCATGACCCTTGTGCCTGGGCGTCCCAAAGATGTGGCCAACTTCTTCC
TA
CTGTTGCTGGTGTTGGCTGTGCTCTTCTTCCACCAGCTGGTCGGTGATCCTCTCAAACGCTACGCCCA
T
GCTCTGGTGTTTGGAATCCTGCTCACTTGCCGCCTGCTGATTGCTCGCAAGCCCGAAGACCGGTCTTCT
GAG
AAGAAGCCTTTGCCAGGGAATGCTGAGGAGCAACCCTCCTTATATGAGAAGGCCCCTCAGGGCAAAG
TG
AAGGTGTCATAG


Translation (167 aa):
MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA
L
EVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS
E
KKPLPGNAEEQPSLYEKAPQGKVKVS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser